prot_C-tenellus_contig684.1.1 (polypeptide) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig684.1.1 vs. uniprot
Match: A0A6H5JPR7_9PHAE (JmjC domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JPR7_9PHAE) HSP 1 Score: 53.5 bits (127), Expect = 4.200e-6 Identity = 33/56 (58.93%), Postives = 37/56 (66.07%), Query Frame = 0 Query: 42 GAVSRRLPSEEQQVLRTKGRFKIIPQSKVPVSGAATVRKGKPPLTAKQKLLAKMKR 97 G V RRL +Q+ LR+KG FKI P SKVP K K PLTAKQKLLAKM+R Sbjct: 870 GGVQRRLSVTKQEALRSKGMFKIAPPSKVPPKP-----KEKKPLTAKQKLLAKMRR 920
BLAST of mRNA_C-tenellus_contig684.1.1 vs. uniprot
Match: D7FTJ5_ECTSI (JmjC domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FTJ5_ECTSI) HSP 1 Score: 52.8 bits (125), Expect = 7.850e-6 Identity = 32/56 (57.14%), Postives = 37/56 (66.07%), Query Frame = 0 Query: 42 GAVSRRLPSEEQQVLRTKGRFKIIPQSKVPVSGAATVRKGKPPLTAKQKLLAKMKR 97 G V RRL +Q+ LR+KG FKI P SKVP K K PLTAKQKL+AKM+R Sbjct: 899 GGVQRRLSVTKQEALRSKGMFKIAPPSKVPPKP-----KEKKPLTAKQKLMAKMRR 949 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig684.1.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_C-tenellus_contig684.1.1 ID=prot_C-tenellus_contig684.1.1|Name=mRNA_C-tenellus_contig684.1.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=98bpback to top |