prot_C-tenellus_contig10469.2.1 (polypeptide) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig10469.2.1 vs. uniprot
Match: A0A6H5JIM0_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JIM0_9PHAE) HSP 1 Score: 60.1 bits (144), Expect = 3.330e-8 Identity = 29/73 (39.73%), Postives = 42/73 (57.53%), Query Frame = 0 Query: 1 MVAIHSINYDNRSFTVRQVTMKMVAKGLNYNTSAINRWLDDMGAMPNHRWIKPKLKSWQKVWRMDFICDQVDK 73 + A+ ++N NRS T+RQV+ ++ GL + + RW +GA IKP L QK RMDFI D+VD+ Sbjct: 71 IAALKTVNSQNRSSTLRQVSDQLTDLGLEFGKDTVRRWFSKLGAAKKAGRIKPSLSDAQKRHRMDFISDRVDE 143 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig10469.2.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_C-tenellus_contig10469.2.1 ID=prot_C-tenellus_contig10469.2.1|Name=mRNA_C-tenellus_contig10469.2.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=115bpback to top |