prot_C-tenellus_contig10380.2.1 (polypeptide) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig10380.2.1 vs. uniprot
Match: A0A6H5KQM7_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KQM7_9PHAE) HSP 1 Score: 70.5 bits (171), Expect = 1.160e-10 Identity = 40/100 (40.00%), Postives = 58/100 (58.00%), Query Frame = 0 Query: 4 FNPSPKVERELEMLIKTMYHKSFIDLVDKSK--LEDLLNPIIFSYHHLGLWCAVRHGVI-CGEQTIRGRFNHHQRDRKRIRRAKKMIRALLEHLKESMLG 100 F PS V ELE L++ ++ +S D + +E ++ P++FSY HLGLWCA+RH V+ C + + DR RI R KK++ L +HL ES LG Sbjct: 51 FTPSQTVVDELESLMRMLFSESMCGFGDSKEKFVEAVVGPVLFSYQHLGLWCAIRHIVMFCEAENLP--------DRSRITRTKKVVLQLTQHLTESPLG 142
BLAST of mRNA_C-tenellus_contig10380.2.1 vs. uniprot
Match: D7FZW2_ECTSI (Dicer-like 3 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FZW2_ECTSI) HSP 1 Score: 53.9 bits (128), Expect = 5.100e-5 Identity = 28/65 (43.08%), Postives = 37/65 (56.92%), Query Frame = 0 Query: 36 EDLLNPIIFSYHHLGLWCAVRHGVICGEQTIRGRFNHHQRDRKRIRRAKKMIRALLEHLKESMLG 100 E ++ P++FSY HLGLWCA+RH + DR RI R KK++ L +HL ES LG Sbjct: 209 EAVVGPVLFSYQHLGLWCAMRHIRVAENLP----------DRSRITRTKKVVLQLTQHLTESPLG 263 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig10380.2.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_C-tenellus_contig10380.2.1 ID=prot_C-tenellus_contig10380.2.1|Name=mRNA_C-tenellus_contig10380.2.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=197bpback to top |