prot_C-tenellus_contig10238.4.1 (polypeptide) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig10238.4.1 vs. uniprot
Match: D7G152_ECTSI (Mcl1_mid domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G152_ECTSI) HSP 1 Score: 68.6 bits (166), Expect = 3.360e-12 Identity = 30/49 (61.22%), Postives = 37/49 (75.51%), Query Frame = 0 Query: 1 AACGEEPGVRVLRRSNIQSMVTLDEHDGGVKSLAWDPNGEFLATSGETG 49 AAC EEPG+RV+RRSN ++TL + GGVKS+ WDP G+FLA SG G Sbjct: 127 AACSEEPGIRVVRRSNNSKVLTLTDMSGGVKSVDWDPRGDFLAASGFDG 175
BLAST of mRNA_C-tenellus_contig10238.4.1 vs. uniprot
Match: A0A6H5KUW1_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KUW1_9PHAE) HSP 1 Score: 67.4 bits (163), Expect = 8.280e-12 Identity = 30/49 (61.22%), Postives = 37/49 (75.51%), Query Frame = 0 Query: 1 AACGEEPGVRVLRRSNIQSMVTLDEHDGGVKSLAWDPNGEFLATSGETG 49 AAC EEPG+RV+RRSN ++TL + GGVKS+ WDP G+FLA SG G Sbjct: 137 AACSEEPGIRVVRRSNNSKVLTLTDMSGGVKSVDWDPCGDFLAASGFDG 185 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig10238.4.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_C-tenellus_contig10238.4.1 ID=prot_C-tenellus_contig10238.4.1|Name=mRNA_C-tenellus_contig10238.4.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=52bpback to top |