mRNA_C-tenellus_contig10238.4.1 (mRNA) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig10238.4.1 vs. uniprot
Match: D7G152_ECTSI (Mcl1_mid domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G152_ECTSI) HSP 1 Score: 68.6 bits (166), Expect = 3.360e-12 Identity = 30/49 (61.22%), Postives = 37/49 (75.51%), Query Frame = 1 Query: 1 AACGEEPGVRVLRRSNIQSMVTLDEHDGGVKSLAWDPNGEFLATSGETG 147 AAC EEPG+RV+RRSN ++TL + GGVKS+ WDP G+FLA SG G Sbjct: 127 AACSEEPGIRVVRRSNNSKVLTLTDMSGGVKSVDWDPRGDFLAASGFDG 175
BLAST of mRNA_C-tenellus_contig10238.4.1 vs. uniprot
Match: A0A6H5KUW1_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KUW1_9PHAE) HSP 1 Score: 67.4 bits (163), Expect = 8.280e-12 Identity = 30/49 (61.22%), Postives = 37/49 (75.51%), Query Frame = 1 Query: 1 AACGEEPGVRVLRRSNIQSMVTLDEHDGGVKSLAWDPNGEFLATSGETG 147 AAC EEPG+RV+RRSN ++TL + GGVKS+ WDP G+FLA SG G Sbjct: 137 AACSEEPGIRVVRRSNNSKVLTLTDMSGGVKSVDWDPCGDFLAASGFDG 185 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig10238.4.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_C-tenellus_contig10238.4.1 >prot_C-tenellus_contig10238.4.1 ID=prot_C-tenellus_contig10238.4.1|Name=mRNA_C-tenellus_contig10238.4.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=52bp AACGEEPGVRVLRRSNIQSMVTLDEHDGGVKSLAWDPNGEFLATSGETGEback to top mRNA from alignment at C-tenellus_contig10238:5029..5184+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_C-tenellus_contig10238.4.1 ID=mRNA_C-tenellus_contig10238.4.1|Name=mRNA_C-tenellus_contig10238.4.1|organism=Choristocarpus tenellus KU2346|type=mRNA|length=156bp|location=Sequence derived from alignment at C-tenellus_contig10238:5029..5184+ (Choristocarpus tenellus KU2346)back to top Coding sequence (CDS) from alignment at C-tenellus_contig10238:5029..5184+ >mRNA_C-tenellus_contig10238.4.1 ID=mRNA_C-tenellus_contig10238.4.1|Name=mRNA_C-tenellus_contig10238.4.1|organism=Choristocarpus tenellus KU2346|type=CDS|length=156bp|location=Sequence derived from alignment at C-tenellus_contig10238:5029..5184+ (Choristocarpus tenellus KU2346)back to top |