prot_C-tenellus_contig10143.1.1 (polypeptide) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig10143.1.1 vs. uniprot
Match: UPI001C7B5080 (uncharacterized protein n=1 Tax=Marasmius oreades TaxID=181124 RepID=UPI001C7B5080) HSP 1 Score: 49.7 bits (117), Expect = 1.820e-5 Identity = 18/47 (38.30%), Postives = 29/47 (61.70%), Query Frame = 0 Query: 4 FMDAPTLCSATEVSQEWKSQGNDDLLWKRLCRSRQADTLHT--WGIP 48 ++DA +LC A++VS+ WK +DD+LW+ +C H WG+P Sbjct: 169 YLDATSLCRASQVSKRWKKLADDDILWRGICEQHIGTKCHKCGWGLP 215
BLAST of mRNA_C-tenellus_contig10143.1.1 vs. uniprot
Match: S8E361_FOMPI (F-box domain-containing protein n=1 Tax=Fomitopsis pinicola (strain FP-58527) TaxID=743788 RepID=S8E361_FOMPI) HSP 1 Score: 49.3 bits (116), Expect = 2.490e-5 Identity = 20/47 (42.55%), Postives = 30/47 (63.83%), Query Frame = 0 Query: 4 FMDAPTLCSATEVSQEWKSQGNDDLLWKRLCRSR--QADTLHTWGIP 48 ++DA +LC A +VS++WKS +DDLLW+ +C Q WG+P Sbjct: 165 YLDATSLCRAAQVSKQWKSLADDDLLWRGICEQHIGQKCLKCGWGLP 211
BLAST of mRNA_C-tenellus_contig10143.1.1 vs. uniprot
Match: A0A1C7MEL1_GRIFR (Putative E3 ubiquitin ligase complex SCF subunit sconB n=1 Tax=Grifola frondosa TaxID=5627 RepID=A0A1C7MEL1_GRIFR) HSP 1 Score: 49.3 bits (116), Expect = 2.500e-5 Identity = 20/47 (42.55%), Postives = 30/47 (63.83%), Query Frame = 0 Query: 4 FMDAPTLCSATEVSQEWKSQGNDDLLWKRLCRSR--QADTLHTWGIP 48 ++DA +LC A +VS++WKS +DDLLW+ +C Q WG+P Sbjct: 172 YLDATSLCRAAQVSRQWKSLADDDLLWRGICEQHIGQKCLKCGWGLP 218
BLAST of mRNA_C-tenellus_contig10143.1.1 vs. uniprot
Match: A0A1X6N8K1_9APHY (F-box domain-containing protein n=2 Tax=Postia placenta TaxID=104341 RepID=A0A1X6N8K1_9APHY) HSP 1 Score: 48.5 bits (114), Expect = 4.670e-5 Identity = 19/47 (40.43%), Postives = 30/47 (63.83%), Query Frame = 0 Query: 4 FMDAPTLCSATEVSQEWKSQGNDDLLWKRLCRSR--QADTLHTWGIP 48 ++DA +LC A +VS++WKS +DD+LW+ +C Q WG+P Sbjct: 176 YLDATSLCRAAQVSRQWKSLADDDILWRGICEQHIGQKCLKCGWGLP 222
BLAST of mRNA_C-tenellus_contig10143.1.1 vs. uniprot
Match: A0A1Y2I946_PYCCO (WD40 repeat-like protein n=1 Tax=Trametes coccinea BRFM310 TaxID=1353009 RepID=A0A1Y2I946_PYCCO) HSP 1 Score: 48.5 bits (114), Expect = 4.670e-5 Identity = 19/47 (40.43%), Postives = 30/47 (63.83%), Query Frame = 0 Query: 4 FMDAPTLCSATEVSQEWKSQGNDDLLWKRLCRSR--QADTLHTWGIP 48 ++DA +LC A +VS++WKS +DD+LW+ +C Q WG+P Sbjct: 190 YLDATSLCRAAQVSRQWKSLADDDILWRGICEQHIGQKCLKCGWGLP 236
BLAST of mRNA_C-tenellus_contig10143.1.1 vs. uniprot
Match: A0A1M2V981_TRAPU (F-box domain-containing protein n=2 Tax=Trametes TaxID=5324 RepID=A0A1M2V981_TRAPU) HSP 1 Score: 48.5 bits (114), Expect = 4.670e-5 Identity = 19/47 (40.43%), Postives = 30/47 (63.83%), Query Frame = 0 Query: 4 FMDAPTLCSATEVSQEWKSQGNDDLLWKRLCRSR--QADTLHTWGIP 48 ++DA +LC A +VS++WKS +DD+LW+ +C Q WG+P Sbjct: 192 YLDATSLCRAAQVSRQWKSLADDDILWRGICEQHIGQKCLKCGWGLP 238
BLAST of mRNA_C-tenellus_contig10143.1.1 vs. uniprot
Match: J4IB24_9APHY (Uncharacterized protein n=1 Tax=Fibroporia radiculosa TaxID=599839 RepID=J4IB24_9APHY) HSP 1 Score: 48.5 bits (114), Expect = 4.700e-5 Identity = 19/47 (40.43%), Postives = 30/47 (63.83%), Query Frame = 0 Query: 4 FMDAPTLCSATEVSQEWKSQGNDDLLWKRLCRSR--QADTLHTWGIP 48 ++DA +LC A +VS++WKS +DD+LW+ +C Q WG+P Sbjct: 173 YLDATSLCRAAQVSRQWKSLADDDILWRGICEQHIGQKCLKCGWGLP 219
BLAST of mRNA_C-tenellus_contig10143.1.1 vs. uniprot
Match: A0A8H3TW55_9TREE (F-box domain-containing protein n=1 Tax=Naganishia liquefaciens TaxID=104408 RepID=A0A8H3TW55_9TREE) HSP 1 Score: 48.1 bits (113), Expect = 6.410e-5 Identity = 21/47 (44.68%), Postives = 31/47 (65.96%), Query Frame = 0 Query: 4 FMDAPTLCSATEVSQEWKSQGNDDLLWKRLCRSR--QADTLHTWGIP 48 F+DA +L A +VS++WKS +DDLLW+R+C + T WG+P Sbjct: 231 FLDAISLGKAAQVSKQWKSLADDDLLWRRMCGQHIERKCTKCGWGLP 277
BLAST of mRNA_C-tenellus_contig10143.1.1 vs. uniprot
Match: A0A0D0DHE3_9AGAM (F-box domain-containing protein n=1 Tax=Paxillus rubicundulus Ve08.2h10 TaxID=930991 RepID=A0A0D0DHE3_9AGAM) HSP 1 Score: 47.8 bits (112), Expect = 8.750e-5 Identity = 18/47 (38.30%), Postives = 29/47 (61.70%), Query Frame = 0 Query: 4 FMDAPTLCSATEVSQEWKSQGNDDLLWKRLCRSRQADTLHT--WGIP 48 ++DA +LC A +VS++W S +DD+LW+ +C T WG+P Sbjct: 171 YLDATSLCRAAQVSKQWHSLADDDILWRGICEQHIGQKCLTCGWGLP 217 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig10143.1.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 9
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_C-tenellus_contig10143.1.1 ID=prot_C-tenellus_contig10143.1.1|Name=mRNA_C-tenellus_contig10143.1.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=56bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|