mRNA_C-tenellus_contig9962.2.1 (mRNA) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig9962.2.1 vs. uniprot
Match: A0A6H5JWK8_9PHAE (Reverse transcriptase Ty1/copia-type domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JWK8_9PHAE) HSP 1 Score: 67.8 bits (164), Expect = 1.390e-11 Identity = 33/58 (56.90%), Postives = 42/58 (72.41%), Query Frame = 1 Query: 4 KLQKSLYGIVQASCNWNALLVASLLELGLEQCEADPCLFRWMLDGELVLTMLIRVDDM 177 +L KSLYG+ QAS W ALL LL LG EQC AD C+FR + DGE+VL +++ VDD+ Sbjct: 16 QLNKSLYGLRQASREWYALLKKCLLALGFEQCMADSCVFRLVEDGEVVLILVVHVDDI 73
BLAST of mRNA_C-tenellus_contig9962.2.1 vs. uniprot
Match: A0A6H5K307_9PHAE (Reverse transcriptase Ty1/copia-type domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K307_9PHAE) HSP 1 Score: 67.4 bits (163), Expect = 2.080e-11 Identity = 33/58 (56.90%), Postives = 42/58 (72.41%), Query Frame = 1 Query: 4 KLQKSLYGIVQASCNWNALLVASLLELGLEQCEADPCLFRWMLDGELVLTMLIRVDDM 177 +L KSLYG+ QAS W ALL LL LG EQC AD CLFR++ GE+VL +++ VDD+ Sbjct: 249 QLNKSLYGLRQASREWYALLKKCLLALGFEQCMADSCLFRFVEGGEVVLLLVVHVDDI 306
BLAST of mRNA_C-tenellus_contig9962.2.1 vs. uniprot
Match: A0A6H5KFD2_9PHAE (Reverse transcriptase Ty1/copia-type domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KFD2_9PHAE) HSP 1 Score: 65.5 bits (158), Expect = 9.720e-11 Identity = 32/58 (55.17%), Postives = 41/58 (70.69%), Query Frame = 1 Query: 4 KLQKSLYGIVQASCNWNALLVASLLELGLEQCEADPCLFRWMLDGELVLTMLIRVDDM 177 +L KSLYG+ QAS W ALL LL LG EQC AD C+FR++ GE VL +++ VDD+ Sbjct: 214 QLNKSLYGLRQASRQWYALLTKCLLALGFEQCMADSCVFRFVEGGEEVLLLVVHVDDI 271
BLAST of mRNA_C-tenellus_contig9962.2.1 vs. uniprot
Match: A0A6H5KEU9_9PHAE (Reverse transcriptase Ty1/copia-type domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KEU9_9PHAE) HSP 1 Score: 65.1 bits (157), Expect = 1.140e-10 Identity = 32/59 (54.24%), Postives = 42/59 (71.19%), Query Frame = 1 Query: 4 KLQKSLYGIVQASCNWNALLVASLLELGLEQCEADPCLFRWMLDGELVLTMLIRVDDML 180 +L KSLYG+ QAS W ALL LL LG EQC AD C+FR + GE+VL +++ VDD++ Sbjct: 245 QLNKSLYGLRQASREWYALLKKCLLALGFEQCMADSCVFRSVEGGEVVLLLVVHVDDIV 303
BLAST of mRNA_C-tenellus_contig9962.2.1 vs. uniprot
Match: A0A6H5JBR0_9PHAE (Reverse transcriptase Ty1/copia-type domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JBR0_9PHAE) HSP 1 Score: 65.1 bits (157), Expect = 1.320e-10 Identity = 32/58 (55.17%), Postives = 41/58 (70.69%), Query Frame = 1 Query: 4 KLQKSLYGIVQASCNWNALLVASLLELGLEQCEADPCLFRWMLDGELVLTMLIRVDDM 177 +L KSLYG+ QAS W ALL LL LG EQC AD C+FR + GE+VL +++ VDD+ Sbjct: 173 QLNKSLYGLRQASREWYALLKKCLLALGFEQCMADSCVFRLVEGGEVVLLLVVHVDDI 230
BLAST of mRNA_C-tenellus_contig9962.2.1 vs. uniprot
Match: A0A6H5KG67_9PHAE (Reverse transcriptase Ty1/copia-type domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KG67_9PHAE) HSP 1 Score: 64.7 bits (156), Expect = 1.840e-10 Identity = 32/58 (55.17%), Postives = 41/58 (70.69%), Query Frame = 1 Query: 4 KLQKSLYGIVQASCNWNALLVASLLELGLEQCEADPCLFRWMLDGELVLTMLIRVDDM 177 +L KSLYG+ QAS W ALL LL LG EQC AD C+FR++ GE+VL + + VDD+ Sbjct: 70 QLNKSLYGLRQASREWYALLKKCLLALGFEQCMADSCVFRFVEGGEVVLLLEVHVDDI 127
BLAST of mRNA_C-tenellus_contig9962.2.1 vs. uniprot
Match: A0A6H5KKQ0_9PHAE (Reverse transcriptase Ty1/copia-type domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KKQ0_9PHAE) HSP 1 Score: 61.2 bits (147), Expect = 2.990e-10 Identity = 26/62 (41.94%), Postives = 43/62 (69.35%), Query Frame = 1 Query: 4 KLQKSLYGIVQASCNWNALLVASLLELGLEQCEADPCLFRWMLDGELVLTMLIRVDDMLMSS 189 K++++LYG+ Q+ W +L+ G EQC DPC+FR ++DGELV ++I VDD+++S+ Sbjct: 47 KVERALYGLKQSGREWGFEAADALISNGYEQCRVDPCIFRKVVDGELVGLIVINVDDIMLSA 108
BLAST of mRNA_C-tenellus_contig9962.2.1 vs. uniprot
Match: A0A6H5KL18_9PHAE (Reverse transcriptase Ty1/copia-type domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KL18_9PHAE) HSP 1 Score: 63.9 bits (154), Expect = 3.470e-10 Identity = 31/58 (53.45%), Postives = 41/58 (70.69%), Query Frame = 1 Query: 4 KLQKSLYGIVQASCNWNALLVASLLELGLEQCEADPCLFRWMLDGELVLTMLIRVDDM 177 +L KSLYG+ QAS W ALL LL LG EQC AD C+FR + G++VL +++ VDD+ Sbjct: 426 QLNKSLYGLRQASREWYALLKKCLLALGFEQCMADSCVFRLVEGGDVVLLLVVHVDDI 483
BLAST of mRNA_C-tenellus_contig9962.2.1 vs. uniprot
Match: A0A6H5JSV9_9PHAE (Reverse transcriptase Ty1/copia-type domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JSV9_9PHAE) HSP 1 Score: 62.0 bits (149), Expect = 3.870e-10 Identity = 31/58 (53.45%), Postives = 39/58 (67.24%), Query Frame = 1 Query: 4 KLQKSLYGIVQASCNWNALLVASLLELGLEQCEADPCLFRWMLDGELVLTMLIRVDDM 177 +L KSLYG+ QAS W ALL LL LG EQC AD C+F + GE+VL + + VDD+ Sbjct: 70 QLNKSLYGLRQASREWYALLKKCLLALGFEQCMADSCVFSLVEKGEVVLILAVHVDDI 127
BLAST of mRNA_C-tenellus_contig9962.2.1 vs. uniprot
Match: A0A6H5KIL0_9PHAE (Integrase catalytic domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KIL0_9PHAE) HSP 1 Score: 63.5 bits (153), Expect = 4.790e-10 Identity = 32/60 (53.33%), Postives = 42/60 (70.00%), Query Frame = 1 Query: 4 KLQKSLYGIVQASCNWN--ALLVASLLELGLEQCEADPCLFRWMLDGELVLTMLIRVDDM 177 +L KSLYG+ QAS W ALL LL LG EQC ADPC+FR++ GE+VL +++ DD+ Sbjct: 717 QLNKSLYGLRQASREWEWYALLKKCLLALGFEQCMADPCVFRFVEGGEVVLLLVVHADDI 776 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig9962.2.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_C-tenellus_contig9962.2.1 >prot_C-tenellus_contig9962.2.1 ID=prot_C-tenellus_contig9962.2.1|Name=mRNA_C-tenellus_contig9962.2.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=73bp WKLQKSLYGIVQASCNWNALLVASLLELGLEQCEADPCLFRWMLDGELVLback to top mRNA from alignment at C-tenellus_contig9962:2050..2268+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_C-tenellus_contig9962.2.1 ID=mRNA_C-tenellus_contig9962.2.1|Name=mRNA_C-tenellus_contig9962.2.1|organism=Choristocarpus tenellus KU2346|type=mRNA|length=219bp|location=Sequence derived from alignment at C-tenellus_contig9962:2050..2268+ (Choristocarpus tenellus KU2346)back to top Coding sequence (CDS) from alignment at C-tenellus_contig9962:2050..2268+ >mRNA_C-tenellus_contig9962.2.1 ID=mRNA_C-tenellus_contig9962.2.1|Name=mRNA_C-tenellus_contig9962.2.1|organism=Choristocarpus tenellus KU2346|type=CDS|length=219bp|location=Sequence derived from alignment at C-tenellus_contig9962:2050..2268+ (Choristocarpus tenellus KU2346)back to top |