mRNA_C-tenellus_contig9926.1.1 (mRNA) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig9926.1.1 vs. uniprot
Match: D7G8M0_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G8M0_ECTSI) HSP 1 Score: 47.0 bits (110), Expect = 9.180e-5 Identity = 22/37 (59.46%), Postives = 30/37 (81.08%), Query Frame = 1 Query: 1 MLETLQANFVARVEWRIHRKMEAHRGRAVMRAAEKEL 111 MLE ++AN AR++WR RK +AHRGRAV+RAA++ L Sbjct: 189 MLEIIKANHAARLQWRAQRKQDAHRGRAVLRAAKRAL 225 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig9926.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_C-tenellus_contig9926.1.1 >prot_C-tenellus_contig9926.1.1 ID=prot_C-tenellus_contig9926.1.1|Name=mRNA_C-tenellus_contig9926.1.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=43bp MLETLQANFVARVEWRIHRKMEAHRGRAVMRAAEKELQKEARRback to top mRNA from alignment at C-tenellus_contig9926:205..333+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_C-tenellus_contig9926.1.1 ID=mRNA_C-tenellus_contig9926.1.1|Name=mRNA_C-tenellus_contig9926.1.1|organism=Choristocarpus tenellus KU2346|type=mRNA|length=129bp|location=Sequence derived from alignment at C-tenellus_contig9926:205..333+ (Choristocarpus tenellus KU2346)back to top Coding sequence (CDS) from alignment at C-tenellus_contig9926:205..333+ >mRNA_C-tenellus_contig9926.1.1 ID=mRNA_C-tenellus_contig9926.1.1|Name=mRNA_C-tenellus_contig9926.1.1|organism=Choristocarpus tenellus KU2346|type=CDS|length=129bp|location=Sequence derived from alignment at C-tenellus_contig9926:205..333+ (Choristocarpus tenellus KU2346)back to top |