mRNA_C-tenellus_contig9751.2.1 (mRNA) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig9751.2.1 vs. uniprot
Match: A0A835ZLF5_9STRA (Uncharacterized protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835ZLF5_9STRA) HSP 1 Score: 59.7 bits (143), Expect = 2.590e-9 Identity = 22/30 (73.33%), Postives = 29/30 (96.67%), Query Frame = 3 Query: 225 LDRYVLCQDCGGLGVRKELYNHMVLEKTCE 314 LD+YV+C++C GLG+RKELYNHMVLE++CE Sbjct: 75 LDKYVICKECSGLGIRKELYNHMVLERSCE 104 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig9751.2.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_C-tenellus_contig9751.2.1 >prot_C-tenellus_contig9751.2.1 ID=prot_C-tenellus_contig9751.2.1|Name=mRNA_C-tenellus_contig9751.2.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=105bp SSLSTLKSEELPEGKGESPVAAATRGREPHANIKEILPCRRAGTETLHRRback to top mRNA from alignment at C-tenellus_contig9751:1243..1558+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_C-tenellus_contig9751.2.1 ID=mRNA_C-tenellus_contig9751.2.1|Name=mRNA_C-tenellus_contig9751.2.1|organism=Choristocarpus tenellus KU2346|type=mRNA|length=316bp|location=Sequence derived from alignment at C-tenellus_contig9751:1243..1558+ (Choristocarpus tenellus KU2346)back to top Coding sequence (CDS) from alignment at C-tenellus_contig9751:1243..1558+ >mRNA_C-tenellus_contig9751.2.1 ID=mRNA_C-tenellus_contig9751.2.1|Name=mRNA_C-tenellus_contig9751.2.1|organism=Choristocarpus tenellus KU2346|type=CDS|length=315bp|location=Sequence derived from alignment at C-tenellus_contig9751:1243..1558+ (Choristocarpus tenellus KU2346)back to top |