mRNA_C-tenellus_contig9437.1.1 (mRNA) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig9437.1.1 vs. uniprot
Match: A0A6H5JYF8_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JYF8_9PHAE) HSP 1 Score: 62.4 bits (150), Expect = 4.340e-10 Identity = 31/50 (62.00%), Postives = 39/50 (78.00%), Query Frame = 1 Query: 1 MRVSGSSGGKIEPGLSSFADEPSMAAAHLRPLLLRASELIPPEHHAKTKV 150 ++ SGS+GGKI+PGLSSFA P AAA++ PLL +ASEL+P E H TKV Sbjct: 25 LKFSGSAGGKIKPGLSSFAASPKDAAAYMLPLLAKASELVPRERHPTTKV 74
BLAST of mRNA_C-tenellus_contig9437.1.1 vs. uniprot
Match: D7FJZ4_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FJZ4_ECTSI) HSP 1 Score: 60.8 bits (146), Expect = 1.590e-9 Identity = 30/50 (60.00%), Postives = 38/50 (76.00%), Query Frame = 1 Query: 1 MRVSGSSGGKIEPGLSSFADEPSMAAAHLRPLLLRASELIPPEHHAKTKV 150 ++ SG++GGKIEPGLSSFA P AA ++ PLL +ASEL+P E H TKV Sbjct: 9 LKFSGAAGGKIEPGLSSFAASPKDAAEYMLPLLAKASELVPRERHPATKV 58
BLAST of mRNA_C-tenellus_contig9437.1.1 vs. uniprot
Match: W4KK45_HETIT (Uncharacterized protein (Fragment) n=1 Tax=Heterobasidion irregulare (strain TC 32-1) TaxID=747525 RepID=W4KK45_HETIT) HSP 1 Score: 48.1 bits (113), Expect = 4.900e-5 Identity = 22/39 (56.41%), Postives = 28/39 (71.79%), Query Frame = 1 Query: 28 KIEPGLSSFADEPSMAAAHLRPLLLRASELIPPEHHAKT 144 K+EPG+SSF+D P +A+L PLL A E IPP HA+T Sbjct: 68 KVEPGISSFSDNPEGVSAYLAPLLAHARERIPPSLHAQT 106 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig9437.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_C-tenellus_contig9437.1.1 >prot_C-tenellus_contig9437.1.1 ID=prot_C-tenellus_contig9437.1.1|Name=mRNA_C-tenellus_contig9437.1.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=50bp MRVSGSSGGKIEPGLSSFADEPSMAAAHLRPLLLRASELIPPEHHAKTKVback to top mRNA from alignment at C-tenellus_contig9437:610..759- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_C-tenellus_contig9437.1.1 ID=mRNA_C-tenellus_contig9437.1.1|Name=mRNA_C-tenellus_contig9437.1.1|organism=Choristocarpus tenellus KU2346|type=mRNA|length=150bp|location=Sequence derived from alignment at C-tenellus_contig9437:610..759- (Choristocarpus tenellus KU2346)back to top Coding sequence (CDS) from alignment at C-tenellus_contig9437:610..759- >mRNA_C-tenellus_contig9437.1.1 ID=mRNA_C-tenellus_contig9437.1.1|Name=mRNA_C-tenellus_contig9437.1.1|organism=Choristocarpus tenellus KU2346|type=CDS|length=150bp|location=Sequence derived from alignment at C-tenellus_contig9437:610..759- (Choristocarpus tenellus KU2346)back to top |