mRNA_C-tenellus_contig9350.1.1 (mRNA) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig9350.1.1 vs. uniprot
Match: D8LLG7_ECTSI (Uncharacterized protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D8LLG7_ECTSI) HSP 1 Score: 58.5 bits (140), Expect = 5.200e-8 Identity = 34/71 (47.89%), Postives = 46/71 (64.79%), Query Frame = 1 Query: 1 SIPMNIRNEWLILETYQQLQTEDKQAEEKKKAR-------------EVILRCKEDLDRQIAQNQERAKRER 174 S+P NIRNEWLILETYQQ+ ++KQAEE ++A+ E + RCK+ LD QI Q R+++ER Sbjct: 2 SVPSNIRNEWLILETYQQILADEKQAEEDRRAQTVTFTCGRLSRSPEALQRCKQGLDEQIQQKLARSEKER 72 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig9350.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_C-tenellus_contig9350.1.1 >prot_C-tenellus_contig9350.1.1 ID=prot_C-tenellus_contig9350.1.1|Name=mRNA_C-tenellus_contig9350.1.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=88bp MNIRNEWLILETYQQLQTEDKQAEEKKKAREVILRCKEDLDRQIAQNQERback to top mRNA from alignment at C-tenellus_contig9350:444..1460- Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_C-tenellus_contig9350.1.1 ID=mRNA_C-tenellus_contig9350.1.1|Name=mRNA_C-tenellus_contig9350.1.1|organism=Choristocarpus tenellus KU2346|type=mRNA|length=1017bp|location=Sequence derived from alignment at C-tenellus_contig9350:444..1460- (Choristocarpus tenellus KU2346)back to top Coding sequence (CDS) from alignment at C-tenellus_contig9350:444..1460- >mRNA_C-tenellus_contig9350.1.1 ID=mRNA_C-tenellus_contig9350.1.1|Name=mRNA_C-tenellus_contig9350.1.1|organism=Choristocarpus tenellus KU2346|type=CDS|length=264bp|location=Sequence derived from alignment at C-tenellus_contig9350:444..1460- (Choristocarpus tenellus KU2346)back to top |