mRNA_C-tenellus_contig935.3.1 (mRNA) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig935.3.1 vs. uniprot
Match: A0A6H5JSM1_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JSM1_9PHAE) HSP 1 Score: 59.7 bits (143), Expect = 4.210e-7 Identity = 28/88 (31.82%), Postives = 49/88 (55.68%), Query Frame = 3 Query: 222 PMPSQLRLGRFLMSTIFVLYFGAALVGALEVLAVHLIIRTWLEVLVNILISLMSFWVGNNIFRWFQDWVVMDPELDPPMWVLDFCTIS 485 P+ +R+ R I+ L G A+VG +E + + WL+++ N + ++F VG IF +WV+ DP L+ P+++LD C +S Sbjct: 60 PVEDNVRVVRHQSFVIWTLCCGTAVVGTMEAMVASYVRPWWLQIMANAGFTFLAFVVGCGIFGHSHEWVLRDPNLEKPLFLLDVCVVS 147 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig935.3.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_C-tenellus_contig935.3.1 >prot_C-tenellus_contig935.3.1 ID=prot_C-tenellus_contig935.3.1|Name=mRNA_C-tenellus_contig935.3.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=96bp MLFNIATPMPSQLRLGRFLMSTIFVLYFGAALVGALEVLAVHLIIRTWLEback to top mRNA from alignment at C-tenellus_contig935:2159..3589+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_C-tenellus_contig935.3.1 ID=mRNA_C-tenellus_contig935.3.1|Name=mRNA_C-tenellus_contig935.3.1|organism=Choristocarpus tenellus KU2346|type=mRNA|length=1431bp|location=Sequence derived from alignment at C-tenellus_contig935:2159..3589+ (Choristocarpus tenellus KU2346)back to top Coding sequence (CDS) from alignment at C-tenellus_contig935:2159..3589+ >mRNA_C-tenellus_contig935.3.1 ID=mRNA_C-tenellus_contig935.3.1|Name=mRNA_C-tenellus_contig935.3.1|organism=Choristocarpus tenellus KU2346|type=CDS|length=288bp|location=Sequence derived from alignment at C-tenellus_contig935:2159..3589+ (Choristocarpus tenellus KU2346)back to top |