mRNA_C-tenellus_contig7883.2.1 (mRNA) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig7883.2.1 vs. uniprot
Match: A0A7S0VUI0_9CRYP (Hypothetical protein (Fragment) n=1 Tax=Hemiselmis tepida TaxID=464990 RepID=A0A7S0VUI0_9CRYP) HSP 1 Score: 66.6 bits (161), Expect = 7.020e-9 Identity = 32/64 (50.00%), Postives = 47/64 (73.44%), Query Frame = 3 Query: 438 EDVKVDLISMVHVGDSAYYRDIVRDAEG-YDRVLFELIVGTDVVSKDDEGRRKIVERVYPTRDQ 626 E+V VD++S+VH+ D YYR+I + A+ +DRVLFELI T +VS D++GRR++ E + P DQ Sbjct: 202 EEVTVDIVSLVHLADPRYYREIQQFADSKHDRVLFELIADTSLVSTDEQGRRRLSEHLLPAPDQ 265
BLAST of mRNA_C-tenellus_contig7883.2.1 vs. uniprot
Match: A0A7S1ECB4_HEMAN (Hypothetical protein (Fragment) n=1 Tax=Hemiselmis andersenii TaxID=464988 RepID=A0A7S1ECB4_HEMAN) HSP 1 Score: 58.5 bits (140), Expect = 3.180e-6 Identity = 27/64 (42.19%), Postives = 45/64 (70.31%), Query Frame = 3 Query: 438 EDVKVDLISMVHVGDSAYYRDIVRDAEG-YDRVLFELIVGTDVVSKDDEGRRKIVERVYPTRDQ 626 +++ VD++S+VH+ D YYR+I + A+ +DRVL+ELI + ++S D EGR ++ E + P DQ Sbjct: 83 KEMTVDIVSLVHLADPRYYREIQQFADSQHDRVLYELIADSSLISTDPEGRSRLKEHLLPAPDQ 146
BLAST of mRNA_C-tenellus_contig7883.2.1 vs. uniprot
Match: A0A7S1E8V3_HEMAN (Hypothetical protein (Fragment) n=3 Tax=Hemiselmis andersenii TaxID=464988 RepID=A0A7S1E8V3_HEMAN) HSP 1 Score: 58.5 bits (140), Expect = 3.590e-6 Identity = 27/64 (42.19%), Postives = 45/64 (70.31%), Query Frame = 3 Query: 438 EDVKVDLISMVHVGDSAYYRDIVRDAEG-YDRVLFELIVGTDVVSKDDEGRRKIVERVYPTRDQ 626 +++ VD++S+VH+ D YYR+I + A+ +DRVL+ELI + ++S D EGR ++ E + P DQ Sbjct: 213 KEMTVDIVSLVHLADPRYYREIQQFADSQHDRVLYELIADSSLISTDPEGRSRLKEHLLPAPDQ 276 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig7883.2.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_C-tenellus_contig7883.2.1 >prot_C-tenellus_contig7883.2.1 ID=prot_C-tenellus_contig7883.2.1|Name=mRNA_C-tenellus_contig7883.2.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=192bp MAGTGPCFAVLALTALPLPAMGFNSQPHPTPYPIKSKMFRHRLVIKAVQGback to top mRNA from alignment at C-tenellus_contig7883:3972..4758+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_C-tenellus_contig7883.2.1 ID=mRNA_C-tenellus_contig7883.2.1|Name=mRNA_C-tenellus_contig7883.2.1|organism=Choristocarpus tenellus KU2346|type=mRNA|length=787bp|location=Sequence derived from alignment at C-tenellus_contig7883:3972..4758+ (Choristocarpus tenellus KU2346)back to top Coding sequence (CDS) from alignment at C-tenellus_contig7883:3972..4758+ >mRNA_C-tenellus_contig7883.2.1 ID=mRNA_C-tenellus_contig7883.2.1|Name=mRNA_C-tenellus_contig7883.2.1|organism=Choristocarpus tenellus KU2346|type=CDS|length=576bp|location=Sequence derived from alignment at C-tenellus_contig7883:3972..4758+ (Choristocarpus tenellus KU2346)back to top |