mRNA_C-tenellus_contig727.9.1 (mRNA) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig727.9.1 vs. uniprot
Match: A0A6H5KWJ1_9PHAE (Methyltranfer_dom domain-containing protein n=2 Tax=Ectocarpus TaxID=2879 RepID=A0A6H5KWJ1_9PHAE) HSP 1 Score: 58.5 bits (140), Expect = 9.520e-9 Identity = 26/38 (68.42%), Postives = 30/38 (78.95%), Query Frame = 1 Query: 1 PMLILVQDYGKLMEGTGELEQVESADWAEETLPTWRHS 114 P I + DY KLMEGTG+LEQVE+ DWAE+T PTWR S Sbjct: 367 PHFISINDYAKLMEGTGQLEQVETDDWAEQTTPTWRLS 404
BLAST of mRNA_C-tenellus_contig727.9.1 vs. uniprot
Match: A0A8J9WID7_9CHLO (2-methyl-6-phytyl-1,4-hydroquinone methyltransferase n=1 Tax=Coccomyxa sp. Obi TaxID=2315456 RepID=A0A8J9WID7_9CHLO) HSP 1 Score: 58.2 bits (139), Expect = 1.300e-8 Identity = 24/38 (63.16%), Postives = 30/38 (78.95%), Query Frame = 1 Query: 1 PMLILVQDYGKLMEGTGELEQVESADWAEETLPTWRHS 114 P + VQ+YG+L+EGTG+LE VE DW +TLPTWRHS Sbjct: 325 PYFVSVQEYGRLLEGTGKLESVEIDDWTPQTLPTWRHS 362
BLAST of mRNA_C-tenellus_contig727.9.1 vs. uniprot
Match: A0A7S2UUJ1_9STRA (Hypothetical protein n=1 Tax=Fibrocapsa japonica TaxID=94617 RepID=A0A7S2UUJ1_9STRA) HSP 1 Score: 56.6 bits (135), Expect = 4.540e-8 Identity = 23/38 (60.53%), Postives = 31/38 (81.58%), Query Frame = 1 Query: 1 PMLILVQDYGKLMEGTGELEQVESADWAEETLPTWRHS 114 P I +DYG+L+EGTG +EQV + DWA+ETLP+WRH+ Sbjct: 343 PFFISYEDYGRLVEGTGTMEQVVTDDWAKETLPSWRHA 380
BLAST of mRNA_C-tenellus_contig727.9.1 vs. uniprot
Match: I0Z6S8_COCSC (S-adenosyl-L-methionine-dependent methyltransferase n=1 Tax=Coccomyxa subellipsoidea (strain C-169) TaxID=574566 RepID=I0Z6S8_COCSC) HSP 1 Score: 56.2 bits (134), Expect = 6.150e-8 Identity = 22/38 (57.89%), Postives = 30/38 (78.95%), Query Frame = 1 Query: 1 PMLILVQDYGKLMEGTGELEQVESADWAEETLPTWRHS 114 P + VQ+YG+L+EGTG++E V+ DW +TLPTWRHS Sbjct: 266 PYFVSVQEYGRLLEGTGKMESVDIDDWTPQTLPTWRHS 303
BLAST of mRNA_C-tenellus_contig727.9.1 vs. uniprot
Match: A0A7S3HQH5_9STRA (Hypothetical protein n=1 Tax=Spumella elongata TaxID=89044 RepID=A0A7S3HQH5_9STRA) HSP 1 Score: 54.3 bits (129), Expect = 9.480e-8 Identity = 24/47 (51.06%), Postives = 32/47 (68.09%), Query Frame = 1 Query: 1 PMLILVQDYGKLMEGTGELEQVESADWAEETLPTWRHSGELVSGMLD 141 P I + DY KLM+GTG L+ VE+ADW +TLP+W HS + G+ D Sbjct: 70 PHFISISDYAKLMQGTGRLQNVETADWTPQTLPSWLHS--IWVGVFD 114
BLAST of mRNA_C-tenellus_contig727.9.1 vs. uniprot
Match: A0A7S3XPM8_HETAK (Hypothetical protein n=1 Tax=Heterosigma akashiwo TaxID=2829 RepID=A0A7S3XPM8_HETAK) HSP 1 Score: 55.5 bits (132), Expect = 1.160e-7 Identity = 22/38 (57.89%), Postives = 33/38 (86.84%), Query Frame = 1 Query: 1 PMLILVQDYGKLMEGTGELEQVESADWAEETLPTWRHS 114 P I ++DY KL+EGTG++E+V SA+WA+ET+P+WRH+ Sbjct: 315 PHFISIEDYVKLIEGTGKMEKVGSANWADETIPSWRHA 352
BLAST of mRNA_C-tenellus_contig727.9.1 vs. uniprot
Match: A0A7S1EXV6_NOCSC (Hypothetical protein n=1 Tax=Noctiluca scintillans TaxID=2966 RepID=A0A7S1EXV6_NOCSC) HSP 1 Score: 53.9 bits (128), Expect = 4.070e-7 Identity = 23/38 (60.53%), Postives = 28/38 (73.68%), Query Frame = 1 Query: 1 PMLILVQDYGKLMEGTGELEQVESADWAEETLPTWRHS 114 P I + Y LMEGTG LE V++ADW E+TLP+WRHS Sbjct: 337 PFFISINSYKDLMEGTGMLEPVKTADWTEQTLPSWRHS 374
BLAST of mRNA_C-tenellus_contig727.9.1 vs. uniprot
Match: A0A0D2MTP6_9CHLO (Methyltransf_11 domain-containing protein n=1 Tax=Monoraphidium neglectum TaxID=145388 RepID=A0A0D2MTP6_9CHLO) HSP 1 Score: 53.1 bits (126), Expect = 4.160e-7 Identity = 23/47 (48.94%), Postives = 34/47 (72.34%), Query Frame = 1 Query: 1 PMLILVQDYGKLMEGTGELEQVESADWAEETLPTWRHSGELVSGMLD 141 P I +Q++ +LMEGTG++E V + DW +TLP+WRHS + G+LD Sbjct: 79 PFFISIQEFCRLMEGTGKMEAVGAEDWTPQTLPSWRHSN--LVGVLD 123
BLAST of mRNA_C-tenellus_contig727.9.1 vs. uniprot
Match: A0A7S0VVD3_9CRYP (Hypothetical protein n=1 Tax=Hemiselmis tepida TaxID=464990 RepID=A0A7S0VVD3_9CRYP) HSP 1 Score: 51.6 bits (122), Expect = 4.750e-7 Identity = 19/38 (50.00%), Postives = 29/38 (76.32%), Query Frame = 1 Query: 1 PMLILVQDYGKLMEGTGELEQVESADWAEETLPTWRHS 114 P + +++YG+LM+GTG+LEQV +W +ET+ WRHS Sbjct: 21 PYFVSIEEYGRLMKGTGKLEQVREENWVKETITAWRHS 58
BLAST of mRNA_C-tenellus_contig727.9.1 vs. uniprot
Match: A0A0M0K741_9EUKA (Methyltranfer_dom domain-containing protein n=1 Tax=Chrysochromulina tobinii TaxID=1460289 RepID=A0A0M0K741_9EUKA) HSP 1 Score: 52.8 bits (125), Expect = 1.020e-6 Identity = 19/38 (50.00%), Postives = 31/38 (81.58%), Query Frame = 1 Query: 1 PMLILVQDYGKLMEGTGELEQVESADWAEETLPTWRHS 114 P I +++YG++M+ TG+L+++ +ADWA ET+P WRHS Sbjct: 245 PYFISIEEYGRIMQRTGKLQKIVTADWATETIPAWRHS 282 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig727.9.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_C-tenellus_contig727.9.1 >prot_C-tenellus_contig727.9.1 ID=prot_C-tenellus_contig727.9.1|Name=mRNA_C-tenellus_contig727.9.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=47bp MLILVQDYGKLMEGTGELEQVESADWAEETLPTWRHSGELVSGMLD*back to top mRNA from alignment at C-tenellus_contig727:16828..16971- Legend: UTRCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_C-tenellus_contig727.9.1 ID=mRNA_C-tenellus_contig727.9.1|Name=mRNA_C-tenellus_contig727.9.1|organism=Choristocarpus tenellus KU2346|type=mRNA|length=144bp|location=Sequence derived from alignment at C-tenellus_contig727:16828..16971- (Choristocarpus tenellus KU2346)back to top Coding sequence (CDS) from alignment at C-tenellus_contig727:16828..16971- >mRNA_C-tenellus_contig727.9.1 ID=mRNA_C-tenellus_contig727.9.1|Name=mRNA_C-tenellus_contig727.9.1|organism=Choristocarpus tenellus KU2346|type=CDS|length=141bp|location=Sequence derived from alignment at C-tenellus_contig727:16828..16971- (Choristocarpus tenellus KU2346)back to top |