mRNA_C-tenellus_contig7192.4.1 (mRNA) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig7192.4.1 vs. uniprot
Match: A0A6H5JJ47_9PHAE (DNA-directed RNA polymerase n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JJ47_9PHAE) HSP 1 Score: 71.6 bits (174), Expect = 7.550e-13 Identity = 35/41 (85.37%), Postives = 38/41 (92.68%), Query Frame = 1 Query: 70 EIDPLDEDISQEDAWVVISSYFSEKGLVRQQLDSFDEVSDS 192 E+DPL+EDISQEDAWVVIS+YFSEKGLVRQQLDSFDE S Sbjct: 96 ELDPLEEDISQEDAWVVISAYFSEKGLVRQQLDSFDEFLQS 136
BLAST of mRNA_C-tenellus_contig7192.4.1 vs. uniprot
Match: D7FHZ3_ECTSI (DNA-directed RNA polymerase subunit beta n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FHZ3_ECTSI) HSP 1 Score: 71.6 bits (174), Expect = 7.730e-13 Identity = 35/41 (85.37%), Postives = 38/41 (92.68%), Query Frame = 1 Query: 70 EIDPLDEDISQEDAWVVISSYFSEKGLVRQQLDSFDEVSDS 192 E+DPL+EDISQEDAWVVIS+YFSEKGLVRQQLDSFDE S Sbjct: 95 ELDPLEEDISQEDAWVVISAYFSEKGLVRQQLDSFDEFLQS 135
BLAST of mRNA_C-tenellus_contig7192.4.1 vs. uniprot
Match: A0A2U1KVS3_ARTAN (DNA-directed RNA polymerase n=1 Tax=Artemisia annua TaxID=35608 RepID=A0A2U1KVS3_ARTAN) HSP 1 Score: 60.8 bits (146), Expect = 2.900e-10 Identity = 34/58 (58.62%), Postives = 40/58 (68.97%), Query Frame = 1 Query: 7 NGHDNVIDLDGMGENYDEYDNEIDPLDEDISQEDAWVVISSYFSEKGLVRQQLDSFDE 180 N DN +D + DE + + +EDI+QEDAW VISSYF EKGLVRQQLDSFDE Sbjct: 9 NNDDNEVDYNNNTMGGDEGEEYGEDEEEDITQEDAWAVISSYFEEKGLVRQQLDSFDE 66
BLAST of mRNA_C-tenellus_contig7192.4.1 vs. uniprot
Match: A0A251V1W7_HELAN (DNA-directed RNA polymerase subunit beta n=7 Tax=Mesangiospermae TaxID=1437183 RepID=A0A251V1W7_HELAN) HSP 1 Score: 63.9 bits (154), Expect = 3.980e-10 Identity = 32/41 (78.05%), Postives = 34/41 (82.93%), Query Frame = 1 Query: 58 EYDNEIDPLDEDISQEDAWVVISSYFSEKGLVRQQLDSFDE 180 EYD D +EDI+QEDAW VISSYF EKGLVRQQLDSFDE Sbjct: 6 EYDQGYDDEEEDITQEDAWAVISSYFEEKGLVRQQLDSFDE 46
BLAST of mRNA_C-tenellus_contig7192.4.1 vs. uniprot
Match: A0A7C8ZGU7_OPUST (DNA-directed RNA polymerase n=1 Tax=Opuntia streptacantha TaxID=393608 RepID=A0A7C8ZGU7_OPUST) HSP 1 Score: 60.5 bits (145), Expect = 4.200e-10 Identity = 30/39 (76.92%), Postives = 33/39 (84.62%), Query Frame = 1 Query: 64 DNEIDPLDEDISQEDAWVVISSYFSEKGLVRQQLDSFDE 180 D E D +EDI+QEDAW VIS+YF EKGLVRQQLDSFDE Sbjct: 22 DGEEDDEEEDITQEDAWAVISAYFEEKGLVRQQLDSFDE 60
BLAST of mRNA_C-tenellus_contig7192.4.1 vs. uniprot
Match: A0A835YQ41_9STRA (DNA-directed RNA polymerase subunit beta n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835YQ41_9STRA) HSP 1 Score: 63.5 bits (153), Expect = 5.430e-10 Identity = 30/37 (81.08%), Postives = 35/37 (94.59%), Query Frame = 1 Query: 70 EIDPLDEDISQEDAWVVISSYFSEKGLVRQQLDSFDE 180 E+DP +E+I+QEDAW VISSYF+EKGLVRQQLDSFDE Sbjct: 8 ELDPHEEEITQEDAWQVISSYFAEKGLVRQQLDSFDE 44
BLAST of mRNA_C-tenellus_contig7192.4.1 vs. uniprot
Match: A0A1U7YXW1_NELNU (DNA-directed RNA polymerase subunit beta n=318 Tax=Magnoliopsida TaxID=3398 RepID=A0A1U7YXW1_NELNU) HSP 1 Score: 63.2 bits (152), Expect = 7.420e-10 Identity = 31/42 (73.81%), Postives = 36/42 (85.71%), Query Frame = 1 Query: 55 DEYDNEIDPLDEDISQEDAWVVISSYFSEKGLVRQQLDSFDE 180 DEYD ++ DE+I+QEDAW VIS+YF EKGLVRQQLDSFDE Sbjct: 5 DEYDPSMNDEDEEITQEDAWAVISAYFEEKGLVRQQLDSFDE 46
BLAST of mRNA_C-tenellus_contig7192.4.1 vs. uniprot
Match: UPI001C689E82 (DNA-directed RNA polymerase II subunit RPB2-like n=1 Tax=Lactuca sativa TaxID=4236 RepID=UPI001C689E82) HSP 1 Score: 59.7 bits (143), Expect = 9.010e-10 Identity = 30/41 (73.17%), Postives = 34/41 (82.93%), Query Frame = 1 Query: 58 EYDNEIDPLDEDISQEDAWVVISSYFSEKGLVRQQLDSFDE 180 E+D + +EDI+QEDAW VISSYF EKGLVRQQLDSFDE Sbjct: 6 EHDQGYNDDEEDITQEDAWTVISSYFEEKGLVRQQLDSFDE 46
BLAST of mRNA_C-tenellus_contig7192.4.1 vs. uniprot
Match: A0A426YEA4_ENSVE (DNA-directed RNA polymerase n=1 Tax=Ensete ventricosum TaxID=4639 RepID=A0A426YEA4_ENSVE) HSP 1 Score: 60.8 bits (146), Expect = 1.320e-9 Identity = 32/49 (65.31%), Postives = 39/49 (79.59%), Query Frame = 1 Query: 64 DNEIDPLDEDISQEDAWVVISSYFSEKGLVRQQLDSFDE-VSDSKQGMM 207 DN DE+I+QEDAW VIS+YF EKGLVRQQLDSFDE +S + QG++ Sbjct: 107 DNHTTMEDEEITQEDAWAVISAYFEEKGLVRQQLDSFDEFISTTMQGIV 155
BLAST of mRNA_C-tenellus_contig7192.4.1 vs. uniprot
Match: A0A7J7LRZ0_9MAGN (DNA-directed RNA polymerase subunit beta n=2 Tax=Mesangiospermae TaxID=1437183 RepID=A0A7J7LRZ0_9MAGN) HSP 1 Score: 61.6 bits (148), Expect = 2.590e-9 Identity = 30/41 (73.17%), Postives = 35/41 (85.37%), Query Frame = 1 Query: 58 EYDNEIDPLDEDISQEDAWVVISSYFSEKGLVRQQLDSFDE 180 EYD +D +E+I+QEDAW VISS+F EKGLVRQQLDSFDE Sbjct: 6 EYDPMVDDEEEEITQEDAWAVISSFFEEKGLVRQQLDSFDE 46 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig7192.4.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_C-tenellus_contig7192.4.1 >prot_C-tenellus_contig7192.4.1 ID=prot_C-tenellus_contig7192.4.1|Name=mRNA_C-tenellus_contig7192.4.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=76bp MSNGHDNVIDLDGMGENYDEYDNEIDPLDEDISQEDAWVVISSYFSEKGLback to top mRNA from alignment at C-tenellus_contig7192:6534..6761+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_C-tenellus_contig7192.4.1 ID=mRNA_C-tenellus_contig7192.4.1|Name=mRNA_C-tenellus_contig7192.4.1|organism=Choristocarpus tenellus KU2346|type=mRNA|length=228bp|location=Sequence derived from alignment at C-tenellus_contig7192:6534..6761+ (Choristocarpus tenellus KU2346)back to top Coding sequence (CDS) from alignment at C-tenellus_contig7192:6534..6761+ >mRNA_C-tenellus_contig7192.4.1 ID=mRNA_C-tenellus_contig7192.4.1|Name=mRNA_C-tenellus_contig7192.4.1|organism=Choristocarpus tenellus KU2346|type=CDS|length=228bp|location=Sequence derived from alignment at C-tenellus_contig7192:6534..6761+ (Choristocarpus tenellus KU2346)back to top |