mRNA_C-tenellus_contig6776.2.1 (mRNA) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig6776.2.1 vs. uniprot
Match: A0A8H3YH63_9TREE (Uncharacterized protein n=1 Tax=Naganishia liquefaciens TaxID=104408 RepID=A0A8H3YH63_9TREE) HSP 1 Score: 53.5 bits (127), Expect = 1.140e-5 Identity = 31/84 (36.90%), Postives = 45/84 (53.57%), Query Frame = 1 Query: 142 GRQVEILCDSGASVHLTLDREDLVSNQPTKHTCTFGNNGKLEAKETGDMVPMVTDKDGKPTRVVLKDVLWVPGLPCRILSTGSI 393 GR+ E DSGAS HLT D+E LV+ P + T G+ +L + G + VTD + + + L+VPGL C +LS + Sbjct: 305 GRKTEFYLDSGASGHLTCDKELLVNPVPYRSAVTIGDGSQLYSTPKGSI--RVTDS------IKVDNALYVPGLACNLLSVREL 380 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig6776.2.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_C-tenellus_contig6776.2.1 >prot_C-tenellus_contig6776.2.1 ID=prot_C-tenellus_contig6776.2.1|Name=mRNA_C-tenellus_contig6776.2.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=132bp MAPGTFPPPPTSGSSNKVDGNQARSFSSFKVTADEEVNKRAVINSSIGRQback to top mRNA from alignment at C-tenellus_contig6776:6134..6529- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_C-tenellus_contig6776.2.1 ID=mRNA_C-tenellus_contig6776.2.1|Name=mRNA_C-tenellus_contig6776.2.1|organism=Choristocarpus tenellus KU2346|type=mRNA|length=396bp|location=Sequence derived from alignment at C-tenellus_contig6776:6134..6529- (Choristocarpus tenellus KU2346)back to top Coding sequence (CDS) from alignment at C-tenellus_contig6776:6134..6529- >mRNA_C-tenellus_contig6776.2.1 ID=mRNA_C-tenellus_contig6776.2.1|Name=mRNA_C-tenellus_contig6776.2.1|organism=Choristocarpus tenellus KU2346|type=CDS|length=396bp|location=Sequence derived from alignment at C-tenellus_contig6776:6134..6529- (Choristocarpus tenellus KU2346)back to top |