mRNA_C-tenellus_contig6763.1.1 (mRNA) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig6763.1.1 vs. uniprot
Match: A0A6H5JBW8_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JBW8_9PHAE) HSP 1 Score: 68.6 bits (166), Expect = 3.760e-13 Identity = 31/44 (70.45%), Postives = 35/44 (79.55%), Query Frame = 1 Query: 1 MERVLQLDHNSADARELRMCCSFANSGPLPLLFIDSIFGTHPEM 132 ME++L L S +ARELR C SFANSGPLPLLF+DSIFG HP M Sbjct: 79 MEKILGLKEGSPEARELRTCTSFANSGPLPLLFVDSIFGAHPGM 122
BLAST of mRNA_C-tenellus_contig6763.1.1 vs. uniprot
Match: D8LM61_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LM61_ECTSI) HSP 1 Score: 68.6 bits (166), Expect = 6.360e-13 Identity = 31/44 (70.45%), Postives = 35/44 (79.55%), Query Frame = 1 Query: 1 MERVLQLDHNSADARELRMCCSFANSGPLPLLFIDSIFGTHPEM 132 ME++L L S +ARELR C SFANSGPLPLLF+DSIFG HP M Sbjct: 104 MEKILGLKEGSPEARELRTCTSFANSGPLPLLFVDSIFGAHPGM 147
BLAST of mRNA_C-tenellus_contig6763.1.1 vs. uniprot
Match: A0A4D9D5S5_9STRA (Uncharacterized protein n=2 Tax=Monodopsidaceae TaxID=425072 RepID=A0A4D9D5S5_9STRA) HSP 1 Score: 51.6 bits (122), Expect = 4.460e-6 Identity = 21/41 (51.22%), Postives = 32/41 (78.05%), Query Frame = 1 Query: 7 RVLQLDHNSADARELRMCCSFANSGPLPLLFIDSIFGTHPE 129 R++ L+ S RE+R+C +FAN+GPLPLLF+D++F HP+ Sbjct: 111 RLVGLNPFSEAGREVRICSTFANAGPLPLLFVDALFKNHPD 151
BLAST of mRNA_C-tenellus_contig6763.1.1 vs. uniprot
Match: A0A7S2SS74_9STRA (Hypothetical protein n=1 Tax=Rhizochromulina marina TaxID=1034831 RepID=A0A7S2SS74_9STRA) HSP 1 Score: 49.3 bits (116), Expect = 2.920e-5 Identity = 22/35 (62.86%), Postives = 26/35 (74.29%), Query Frame = 1 Query: 10 VLQLDHNSADARELRMCCSFANSGPLPLLFIDSIF 114 VL++ S RELRM C+F NSGPLPLLF DS+F Sbjct: 174 VLRVPRESIPGRELRMSCAFGNSGPLPLLFADSLF 208 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig6763.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 4
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_C-tenellus_contig6763.1.1 >prot_C-tenellus_contig6763.1.1 ID=prot_C-tenellus_contig6763.1.1|Name=mRNA_C-tenellus_contig6763.1.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=60bp MERVLQLDHNSADARELRMCCSFANSGPLPLLFIDSIFGTHPEMGGGGGGback to top mRNA from alignment at C-tenellus_contig6763:5922..7035+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_C-tenellus_contig6763.1.1 ID=mRNA_C-tenellus_contig6763.1.1|Name=mRNA_C-tenellus_contig6763.1.1|organism=Choristocarpus tenellus KU2346|type=mRNA|length=1114bp|location=Sequence derived from alignment at C-tenellus_contig6763:5922..7035+ (Choristocarpus tenellus KU2346)back to top Coding sequence (CDS) from alignment at C-tenellus_contig6763:5922..7035+ >mRNA_C-tenellus_contig6763.1.1 ID=mRNA_C-tenellus_contig6763.1.1|Name=mRNA_C-tenellus_contig6763.1.1|organism=Choristocarpus tenellus KU2346|type=CDS|length=180bp|location=Sequence derived from alignment at C-tenellus_contig6763:5922..7035+ (Choristocarpus tenellus KU2346)back to top |