mRNA_C-tenellus_contig10791.4.1 (mRNA) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig10791.4.1 vs. uniprot
Match: A0A6H5K9J8_9PHAE (EF-hand domain-containing protein n=2 Tax=Ectocarpus TaxID=2879 RepID=A0A6H5K9J8_9PHAE) HSP 1 Score: 57.8 bits (138), Expect = 1.130e-8 Identity = 27/38 (71.05%), Postives = 34/38 (89.47%), Query Frame = 1 Query: 1 IDPDRHSVVELLLESYHRQLVLVEHDLAALSQEIQSMQ 114 +D RHSVVELLLE+YHRQLVLV HD+AA+ QE++S+Q Sbjct: 447 LDAHRHSVVELLLENYHRQLVLVGHDVAAMKQEMESLQ 484 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig10791.4.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_C-tenellus_contig10791.4.1 >prot_C-tenellus_contig10791.4.1 ID=prot_C-tenellus_contig10791.4.1|Name=mRNA_C-tenellus_contig10791.4.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=38bp IDPDRHSVVELLLESYHRQLVLVEHDLAALSQEIQSMQback to top mRNA from alignment at C-tenellus_contig10791:5160..5273- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_C-tenellus_contig10791.4.1 ID=mRNA_C-tenellus_contig10791.4.1|Name=mRNA_C-tenellus_contig10791.4.1|organism=Choristocarpus tenellus KU2346|type=mRNA|length=114bp|location=Sequence derived from alignment at C-tenellus_contig10791:5160..5273- (Choristocarpus tenellus KU2346)back to top Coding sequence (CDS) from alignment at C-tenellus_contig10791:5160..5273- >mRNA_C-tenellus_contig10791.4.1 ID=mRNA_C-tenellus_contig10791.4.1|Name=mRNA_C-tenellus_contig10791.4.1|organism=Choristocarpus tenellus KU2346|type=CDS|length=114bp|location=Sequence derived from alignment at C-tenellus_contig10791:5160..5273- (Choristocarpus tenellus KU2346)back to top |