mRNA_C-tenellus_contig10601.4.1 (mRNA) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig10601.4.1 vs. uniprot
Match: D7FSC3_ECTSI (Cellulose synthase (UDP-forming), family GT2 n=2 Tax=Ectocarpus TaxID=2879 RepID=D7FSC3_ECTSI) HSP 1 Score: 60.1 bits (144), Expect = 1.810e-9 Identity = 31/39 (79.49%), Postives = 32/39 (82.05%), Query Frame = 1 Query: 1 VAILLPTAGENLMVVLKALLGASSQRLWDSGQPVSGTLR 117 V ILLPTAGENL VV KAL+GA SQRLWDSG P S TLR Sbjct: 357 VCILLPTAGENLEVVFKALVGALSQRLWDSGLPGSQTLR 395
BLAST of mRNA_C-tenellus_contig10601.4.1 vs. uniprot
Match: D7FSC4_ECTSI (Cellulose synthase (UDP-forming), family GT2 n=2 Tax=Ectocarpus TaxID=2879 RepID=D7FSC4_ECTSI) HSP 1 Score: 47.8 bits (112), Expect = 4.070e-5 Identity = 25/30 (83.33%), Postives = 25/30 (83.33%), Query Frame = 1 Query: 1 VAILLPTAGENLMVVLKALLGASSQRLWDS 90 VAILLPTAGE L VVLK LLGASSQR W S Sbjct: 174 VAILLPTAGERLDVVLKCLLGASSQRSWPS 203 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig10601.4.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_C-tenellus_contig10601.4.1 >prot_C-tenellus_contig10601.4.1 ID=prot_C-tenellus_contig10601.4.1|Name=mRNA_C-tenellus_contig10601.4.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=39bp VAILLPTAGENLMVVLKALLGASSQRLWDSGQPVSGTLRback to top mRNA from alignment at C-tenellus_contig10601:5282..5398- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_C-tenellus_contig10601.4.1 ID=mRNA_C-tenellus_contig10601.4.1|Name=mRNA_C-tenellus_contig10601.4.1|organism=Choristocarpus tenellus KU2346|type=mRNA|length=117bp|location=Sequence derived from alignment at C-tenellus_contig10601:5282..5398- (Choristocarpus tenellus KU2346)back to top Coding sequence (CDS) from alignment at C-tenellus_contig10601:5282..5398- >mRNA_C-tenellus_contig10601.4.1 ID=mRNA_C-tenellus_contig10601.4.1|Name=mRNA_C-tenellus_contig10601.4.1|organism=Choristocarpus tenellus KU2346|type=CDS|length=117bp|location=Sequence derived from alignment at C-tenellus_contig10601:5282..5398- (Choristocarpus tenellus KU2346)back to top |