mRNA_C-tenellus_contig10461.2.1 (mRNA) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig10461.2.1 vs. uniprot
Match: A0A024UDY7_9STRA (Serine protease n=1 Tax=Aphanomyces invadans TaxID=157072 RepID=A0A024UDY7_9STRA) HSP 1 Score: 47.4 bits (111), Expect = 8.820e-5 Identity = 19/48 (39.58%), Postives = 32/48 (66.67%), Query Frame = 1 Query: 1 LLRELVKSVYVKNVDPRSGRRFYTNRRTGEVTYKKSICFGADDLETPR 144 LLR++++ +Y K++DP+S +Y N +T +V Y K + G DD+E R Sbjct: 138 LLRDMIRDMYQKHMDPKSKEYYYLNTQTRQVFYTKPVFLGDDDIELER 185 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig10461.2.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_C-tenellus_contig10461.2.1 >prot_C-tenellus_contig10461.2.1 ID=prot_C-tenellus_contig10461.2.1|Name=mRNA_C-tenellus_contig10461.2.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=49bp LLRELVKSVYVKNVDPRSGRRFYTNRRTGEVTYKKSICFGADDLETPR*back to top mRNA from alignment at C-tenellus_contig10461:4498..4644+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_C-tenellus_contig10461.2.1 ID=mRNA_C-tenellus_contig10461.2.1|Name=mRNA_C-tenellus_contig10461.2.1|organism=Choristocarpus tenellus KU2346|type=mRNA|length=147bp|location=Sequence derived from alignment at C-tenellus_contig10461:4498..4644+ (Choristocarpus tenellus KU2346)back to top Coding sequence (CDS) from alignment at C-tenellus_contig10461:4498..4644+ >mRNA_C-tenellus_contig10461.2.1 ID=mRNA_C-tenellus_contig10461.2.1|Name=mRNA_C-tenellus_contig10461.2.1|organism=Choristocarpus tenellus KU2346|type=CDS|length=147bp|location=Sequence derived from alignment at C-tenellus_contig10461:4498..4644+ (Choristocarpus tenellus KU2346)back to top |