mRNA_C-tenellus_contig10437.2.1 (mRNA) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig10437.2.1 vs. uniprot
Match: A0A6H5L3V7_9PHAE (GT24 protein (Fragment) n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L3V7_9PHAE) HSP 1 Score: 66.6 bits (161), Expect = 1.680e-11 Identity = 33/53 (62.26%), Postives = 40/53 (75.47%), Query Frame = 1 Query: 1 GRTQHVSLTAPWPTSCLSPLAEAAEFLAEGDEREELLWEYAEALTGIPEWMHS 159 GRTQ VS++APWPTSCLSPLAEA+EF+AEG + L W+Y EAL P + S Sbjct: 56 GRTQFVSVSAPWPTSCLSPLAEASEFVAEGGDG--LFWDYVEALGDAPHSLFS 106
BLAST of mRNA_C-tenellus_contig10437.2.1 vs. uniprot
Match: D7G655_ECTSI (UDP-glucose:glycoprotein glucosyltransferase, N-terminal, family GT24 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G655_ECTSI) HSP 1 Score: 65.9 bits (159), Expect = 3.130e-11 Identity = 33/53 (62.26%), Postives = 39/53 (73.58%), Query Frame = 1 Query: 1 GRTQHVSLTAPWPTSCLSPLAEAAEFLAEGDEREELLWEYAEALTGIPEWMHS 159 GRTQ VS++APWPTSCLSPLAEA+EF+AEG L W+Y EAL P + S Sbjct: 56 GRTQFVSVSAPWPTSCLSPLAEASEFVAEGGGG--LFWDYVEALADAPHSLFS 106 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig10437.2.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_C-tenellus_contig10437.2.1 >prot_C-tenellus_contig10437.2.1 ID=prot_C-tenellus_contig10437.2.1|Name=mRNA_C-tenellus_contig10437.2.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=53bp GRTQHVSLTAPWPTSCLSPLAEAAEFLAEGDEREELLWEYAEALTGIPEWback to top mRNA from alignment at C-tenellus_contig10437:4806..4964- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_C-tenellus_contig10437.2.1 ID=mRNA_C-tenellus_contig10437.2.1|Name=mRNA_C-tenellus_contig10437.2.1|organism=Choristocarpus tenellus KU2346|type=mRNA|length=159bp|location=Sequence derived from alignment at C-tenellus_contig10437:4806..4964- (Choristocarpus tenellus KU2346)back to top Coding sequence (CDS) from alignment at C-tenellus_contig10437:4806..4964- >mRNA_C-tenellus_contig10437.2.1 ID=mRNA_C-tenellus_contig10437.2.1|Name=mRNA_C-tenellus_contig10437.2.1|organism=Choristocarpus tenellus KU2346|type=CDS|length=159bp|location=Sequence derived from alignment at C-tenellus_contig10437:4806..4964- (Choristocarpus tenellus KU2346)back to top |