mRNA_C-tenellus_contig10300.1.1 (mRNA) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig10300.1.1 vs. uniprot
Match: D8LBM3_ECTSI (TPT domain-containing protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D8LBM3_ECTSI) HSP 1 Score: 55.1 bits (131), Expect = 1.210e-7 Identity = 23/41 (56.10%), Postives = 32/41 (78.05%), Query Frame = 1 Query: 1 TTMLGMMGVGGQYNFDPLNFAALSISMIGSFVYSWAKISKR 123 TT++GM+G+G Y F+ LN A + +SM GSF+YSWAK+ KR Sbjct: 327 TTVVGMLGMGDDYEFEALNCAGMVVSMGGSFLYSWAKVMKR 367 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig10300.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_C-tenellus_contig10300.1.1 >prot_C-tenellus_contig10300.1.1 ID=prot_C-tenellus_contig10300.1.1|Name=mRNA_C-tenellus_contig10300.1.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=40bp MLGMMGVGGQYNFDPLNFAALSISMIGSFVYSWAKISKR*back to top mRNA from alignment at C-tenellus_contig10300:81..206+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_C-tenellus_contig10300.1.1 ID=mRNA_C-tenellus_contig10300.1.1|Name=mRNA_C-tenellus_contig10300.1.1|organism=Choristocarpus tenellus KU2346|type=mRNA|length=126bp|location=Sequence derived from alignment at C-tenellus_contig10300:81..206+ (Choristocarpus tenellus KU2346)back to top Coding sequence (CDS) from alignment at C-tenellus_contig10300:81..206+ >mRNA_C-tenellus_contig10300.1.1 ID=mRNA_C-tenellus_contig10300.1.1|Name=mRNA_C-tenellus_contig10300.1.1|organism=Choristocarpus tenellus KU2346|type=CDS|length=120bp|location=Sequence derived from alignment at C-tenellus_contig10300:81..206+ (Choristocarpus tenellus KU2346)back to top |