mRNA_C-tenellus_contig10259.1.1 (mRNA) Choristocarpus tenellus KU2346
Overview
Homology
BLAST of mRNA_C-tenellus_contig10259.1.1 vs. uniprot
Match: D7FPV9_ECTSI (Uncharacterized protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D7FPV9_ECTSI) HSP 1 Score: 87.4 bits (215), Expect = 1.350e-16 Identity = 55/84 (65.48%), Postives = 60/84 (71.43%), Query Frame = 1 Query: 1 RGERLRRREEEREAKRAAKRVKLGKCPKAPGRSDSHEDRGKKRATKRRLEVARLGRLVAKQEELLGDYHPPKVKEVLDPELKRK 252 RGERLR+RE ER KRA KR KLGK P RS +E + KK A KRRLE+ARL RLV+KQEELL DY PP LDPELKRK Sbjct: 3 RGERLRKREAERAEKRAKKRRKLGKKPLTVDRSGGYESQPKKHANKRRLELARLERLVSKQEELLRDYRPPVHVAPLDPELKRK 86 The following BLAST results are available for this feature:
BLAST of mRNA_C-tenellus_contig10259.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_C-tenellus_contig10259.1.1 >prot_C-tenellus_contig10259.1.1 ID=prot_C-tenellus_contig10259.1.1|Name=mRNA_C-tenellus_contig10259.1.1|organism=Choristocarpus tenellus KU2346|type=polypeptide|length=156bp RGERLRRREEEREAKRAAKRVKLGKCPKAPGRSDSHEDRGKKRATKRRLEback to top mRNA from alignment at C-tenellus_contig10259:3..1321- Legend: polypeptideCDSUTR Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_C-tenellus_contig10259.1.1 ID=mRNA_C-tenellus_contig10259.1.1|Name=mRNA_C-tenellus_contig10259.1.1|organism=Choristocarpus tenellus KU2346|type=mRNA|length=1319bp|location=Sequence derived from alignment at C-tenellus_contig10259:3..1321- (Choristocarpus tenellus KU2346)back to top Coding sequence (CDS) from alignment at C-tenellus_contig10259:3..1321- >mRNA_C-tenellus_contig10259.1.1 ID=mRNA_C-tenellus_contig10259.1.1|Name=mRNA_C-tenellus_contig10259.1.1|organism=Choristocarpus tenellus KU2346|type=CDS|length=468bp|location=Sequence derived from alignment at C-tenellus_contig10259:3..1321- (Choristocarpus tenellus KU2346)back to top |