|
|
Homology
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
| IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
|---|
| IPR000048 | IQ motif, EF-hand binding site | SMART | SM00015 | iq_5 | coord: 26..48
e-value: 0.019
score: 24.2
coord: 51..73
e-value: 4.7
score: 16.2
coord: 97..119
e-value: 24.0
score: 10.5
coord: 3..25
e-value: 270.0
score: 1.9
coord: 74..96
e-value: 130.0
score: 4.6
coord: 129..151
e-value: 410.0
score: 0.3 |
| IPR000048 | IQ motif, EF-hand binding site | PFAM | PF00612 | IQ | coord: 28..46
e-value: 0.0017
score: 17.9
coord: 54..72
e-value: 0.21
score: 11.5
coord: 102..117
e-value: 0.039
score: 13.8 |
| IPR000048 | IQ motif, EF-hand binding site | PROSITE | PS50096 | IQ | coord: 27..55
score: 9.267 |
| IPR000048 | IQ motif, EF-hand binding site | PROSITE | PS50096 | IQ | coord: 98..124
score: 8.462 |
| IPR000048 | IQ motif, EF-hand binding site | PROSITE | PS50096 | IQ | coord: 52..81
score: 6.705 |
| None | No IPR available | GENE3D | 1.20.5.190 | | coord: 56..100
e-value: 1.5E-5
score: 26.5
coord: 2..55
e-value: 3.7E-7
score: 31.7 |
| None | No IPR available | GENE3D | 1.20.5.190 | | coord: 101..146
e-value: 4.8E-5
score: 25.0 |
| None | No IPR available | PANTHER | PTHR22590 | UNCHARACTERIZED | coord: 5..162 |
| None | No IPR available | PANTHER | PTHR22590:SF5 | | coord: 5..162 |
| None | No IPR available | PHOBIUS | SIGNAL_PEPTIDE_N_REGION | Signal peptide N-region | coord: 1..28 |
| None | No IPR available | PHOBIUS | SIGNAL_PEPTIDE | Signal Peptide | coord: 1..43 |
| None | No IPR available | PHOBIUS | NON_CYTOPLASMIC_DOMAIN | Non cytoplasmic domain | coord: 44..199 |
| None | No IPR available | PHOBIUS | SIGNAL_PEPTIDE_H_REGION | Signal peptide H-region | coord: 29..38 |
| None | No IPR available | PHOBIUS | SIGNAL_PEPTIDE_C_REGION | Signal peptide C-region | coord: 39..43 |
| IPR027417 | P-loop containing nucleoside triphosphate hydrolase | SUPERFAMILY | 52540 | P-loop containing nucleoside triphosphate hydrolases | coord: 4..79 |
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_C-linearis_contig87.16268.1 ID=prot_C-linearis_contig87.16268.1|Name=mRNA_C-linearis_contig87.16268.1|organism=Chordaria linearis ClinC8C monoicous|type=polypeptide|length=199bp
MAAMRHAAVRVQVVVRGRKEFWLFRKKRAAAVSLQAWFRGIFARREVEMT
RRQRAVAILQAWARAAMARKGFLRKKKATVTLQVCWRGALAAVAARAREA
VVVRIQALYRGRVVRKQREKAEQRAWMAATHNAAVRVQAVVRGGKEFWLF
PKKRAAAVSLQAWFLDMAPENLGPLLTMMCRGVTNSDGETCFQRCFLTS back to top
Annotated Terms
The following terms have been associated with this polypeptide:
|