prot_C-linearis_contig103.841.1 (polypeptide) Chordaria linearis ClinC8C monoicous

You are viewing a polypeptide, more information available on the corresponding mRNA page

Homology
The following BLAST results are available for this feature:
BLAST of mRNA_C-linearis_contig103.841.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 10
ZOOM
x 1
POSITION
0
MRGITVIALSALLAAMAAIAEAGPLAALTAYGSCQTGCNILVCACYASAGAVFGAATGGAAVPAAIIGCNAGLGSCMAACWAVTGAAAAAPTL*102030405060708090Expect = 2.18e-11 / Id = 67.92Expect = 4.08e-8 / Id = 72.97Expect = 3.06e-7 / Id = 58.00Expect = 6.71e-7 / Id = 51.79Expect = 3.58e-6 / Id = 61.70Expect = 7.58e-6 / Id = 60.87Expect = 8.48e-6 / Id = 51.85Expect = 1.77e-5 / Id = 57.45Expect = 4.09e-5 / Id = 56.14Expect = 8.16e-5 / Id = 53.70SequenceA0A699Z5H6_HAELAA0A1Z5KQC9_FISSOA0A166DKA2_9AGAMA0A8H7VBU9_9FUNGA0A662WWU6_9STRAA0A3R7XRR3_9STRAD8TTS0_VOLCAA0A5N6KR01_9ROSIA0A0D0DFW0_9AGAMA0A0C9U9H6_PAXIN
Match NameE-valueIdentityDescription
A0A699Z5H6_HAELA2.180e-1167.92Uncharacterized protein (Fragment) n=1 Tax=Haemato... [more]
A0A1Z5KQC9_FISSO4.080e-872.97Uncharacterized protein n=1 Tax=Fistulifera solari... [more]
A0A166DKA2_9AGAM3.060e-758.00Uncharacterized protein n=1 Tax=Peniophora sp. CON... [more]
A0A8H7VBU9_9FUNG6.710e-751.79Uncharacterized protein n=1 Tax=Mucor saturninus T... [more]
A0A662WWU6_9STRA3.580e-661.70Protein kinase domain-containing protein n=1 Tax=N... [more]
A0A3R7XRR3_9STRA7.580e-660.87Uncharacterized protein n=2 Tax=Peronospora effusa... [more]
D8TTS0_VOLCA8.480e-651.85Uncharacterized protein lzy1b-1 n=3 Tax=Volvox car... [more]
A0A5N6KR01_9ROSI1.770e-557.45Electron-transferring-flavoprotein dehydrogenase n... [more]
A0A0D0DFW0_9AGAM4.090e-556.14Unplaced genomic scaffold scaffold_1304, whole gen... [more]
A0A0C9U9H6_PAXIN8.160e-553.70Uncharacterized protein n=2 Tax=Paxillus involutus... [more]
back to top