prot_C-linearis_contig102.779.1 (polypeptide) Chordaria linearis ClinC8C monoicous

You are viewing a polypeptide, more information available on the corresponding mRNA page

Homology
The following BLAST results are available for this feature:
BLAST of mRNA_C-linearis_contig102.779.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 25
ZOOM
x 1
POSITION
0
MHPLVRNLCKRFILAARRHPSGEAWFKEKVRQALQRNALLTSYEDVKRAVARGRQVVRDSEEFSQFSRYRAMRRRYSDPDKK*1020304050607080Expect = 2.90e-14 / Id = 47.44Expect = 4.25e-14 / Id = 45.57Expect = 4.86e-11 / Id = 47.44Expect = 1.30e-10 / Id = 41.56Expect = 2.52e-10 / Id = 43.42Expect = 6.17e-10 / Id = 37.66Expect = 1.70e-9 / Id = 41.03Expect = 1.42e-8 / Id = 36.36Expect = 2.01e-8 / Id = 37.18Expect = 2.42e-8 / Id = 37.66SequenceA0A7S1UA59_9STRAA0A8J5XPH7_DIALTL1J1M7_GUITCA0A6G0WG47_9STRAA0A5A8CP96_CAFROH2SF26_TAKRUA0A7S2C6K2_9STRAA0A673BKI3_9TELEG3Q5T1_GASACA0A067CLU1_SAPPC
Match NameE-valueIdentityDescription
A0A7S1UA59_9STRA2.900e-1447.44Hypothetical protein n=1 Tax=Phaeomonas parva TaxI... [more]
A0A8J5XPH7_DIALT4.250e-1445.57Uncharacterized protein n=2 Tax=Diacronema lutheri... [more]
L1J1M7_GUITC4.860e-1147.44Uncharacterized protein n=1 Tax=Guillardia theta (... [more]
A0A6G0WG47_9STRA1.300e-1041.56Uncharacterized protein n=1 Tax=Aphanomyces euteic... [more]
A0A5A8CP96_CAFRO2.520e-1043.42Complex1_LYR_dom domain-containing protein n=1 Tax... [more]
H2SF26_TAKRU6.170e-1037.66Complex1_LYR_dom domain-containing protein n=12 Ta... [more]
A0A7S2C6K2_9STRA1.700e-941.03Hypothetical protein (Fragment) n=1 Tax=Florenciel... [more]
A0A673BKI3_9TELE1.420e-836.36LYR motif-containing protein 5A n=6 Tax=Percomorph... [more]
G3Q5T1_GASAC2.010e-837.18LYR motif containing 5a n=2 Tax=Gasterosteidae Tax... [more]
A0A067CLU1_SAPPC2.420e-837.66Uncharacterized protein n=2 Tax=Saprolegnia TaxID=... [more]

Pages

back to top