prot_C-linearis_contig100.702.1 (polypeptide) Chordaria linearis ClinC8C monoicous

You are viewing a polypeptide, more information available on the corresponding mRNA page

Homology
The following BLAST results are available for this feature:
BLAST of mRNA_C-linearis_contig100.702.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 25
ZOOM
x 1
POSITION
0
VKVPRITFEVKVGKQGMSFHRKQFPLRVCYAITINKSQGQTLSRVGLDLRSDVFCHGQLYVALSRTTSSKNI10203040506070Expect = 3.86e-25 / Id = 68.06Expect = 2.37e-24 / Id = 68.06Expect = 3.81e-24 / Id = 68.06Expect = 1.05e-22 / Id = 65.28Expect = 3.54e-22 / Id = 65.28Expect = 5.69e-21 / Id = 61.11Expect = 1.21e-20 / Id = 61.11Expect = 1.39e-20 / Id = 63.24Expect = 1.68e-20 / Id = 62.32Expect = 1.82e-20 / Id = 54.17SequenceA0A6H5KXS1_9PHAEA0A6H5JNR7_9PHAEA0A6H5JZJ6_9PHAEA0A6H5J9C5_9PHAEA0A6H5KLU2_9PHAEA0A6H5L0V2_9PHAEUPI001ED89BAAA0A3L6EMH1_MAIZEA0A2G3AQD7_CAPCHUPI000E704C93
Match NameE-valueIdentityDescription
A0A6H5KXS1_9PHAE3.860e-2568.06ATP-dependent DNA helicase (Fragment) n=1 Tax=Ecto... [more]
A0A6H5JNR7_9PHAE2.370e-2468.06ATP-dependent DNA helicase n=1 Tax=Ectocarpus sp. ... [more]
A0A6H5JZJ6_9PHAE3.810e-2468.06ATP-dependent DNA helicase n=1 Tax=Ectocarpus sp. ... [more]
A0A6H5J9C5_9PHAE1.050e-2265.28ATP-dependent DNA helicase n=1 Tax=Ectocarpus sp. ... [more]
A0A6H5KLU2_9PHAE3.540e-2265.28ATP-dependent DNA helicase (Fragment) n=1 Tax=Ecto... [more]
A0A6H5L0V2_9PHAE5.690e-2161.11ATP-dependent DNA helicase n=1 Tax=Ectocarpus sp. ... [more]
UPI001ED89BAA1.210e-2061.11ATP-dependent DNA helicase PIF1-like n=2 Tax=Ischn... [more]
A0A3L6EMH1_MAIZE1.390e-2063.24ATP-dependent DNA helicase PIF1 n=1 Tax=Zea mays T... [more]
A0A2G3AQD7_CAPCH1.680e-2062.32ATP-dependent DNA helicase n=1 Tax=Capsicum chinen... [more]
UPI000E704C931.820e-2054.17ATP-dependent DNA helicase PIF1-like n=1 Tax=Papav... [more]

Pages

back to top