mRNA_C-linearis_contig96.17042.1 (mRNA) Chordaria linearis ClinC8C monoicous
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_C-linearis_contig96.17042.1 vs. uniprot
Match: D7G4C0_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G4C0_ECTSI) HSP 1 Score: 63.2 bits (152), Expect = 1.270e-12 Identity = 30/36 (83.33%), Postives = 32/36 (88.89%), Query Frame = 1 Query: 1 MGPCMEDLTYKSTERLLFGPSLQTSLAPVCSPAALK 108 MGPCMEDLTYKSTERLLF PSL+TS APVC AAL+ Sbjct: 1 MGPCMEDLTYKSTERLLFDPSLRTSHAPVCHRAALE 36
BLAST of mRNA_C-linearis_contig96.17042.1 vs. uniprot
Match: D7G4A4_ECTSI (Uncharacterized protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D7G4A4_ECTSI) HSP 1 Score: 65.9 bits (159), Expect = 1.460e-11 Identity = 31/36 (86.11%), Postives = 33/36 (91.67%), Query Frame = 1 Query: 1 MGPCMEDLTYKSTERLLFGPSLQTSLAPVCSPAALK 108 MGPCMEDLTYKSTERLLFGPSL+TS APVC AAL+ Sbjct: 161 MGPCMEDLTYKSTERLLFGPSLRTSHAPVCHRAALE 196 The following BLAST results are available for this feature:
BLAST of mRNA_C-linearis_contig96.17042.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_C-linearis_contig96.17042.1 >prot_C-linearis_contig96.17042.1 ID=prot_C-linearis_contig96.17042.1|Name=mRNA_C-linearis_contig96.17042.1|organism=Chordaria linearis ClinC8C monoicous|type=polypeptide|length=36bp MGPCMEDLTYKSTERLLFGPSLQTSLAPVCSPAALKback to top mRNA from alignment at C-linearis_contig96:441279..441826+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_C-linearis_contig96.17042.1 ID=mRNA_C-linearis_contig96.17042.1|Name=mRNA_C-linearis_contig96.17042.1|organism=Chordaria linearis ClinC8C monoicous|type=mRNA|length=548bp|location=Sequence derived from alignment at C-linearis_contig96:441279..441826+ (Chordaria linearis ClinC8C monoicous)back to top Coding sequence (CDS) from alignment at C-linearis_contig96:441279..441826+ >mRNA_C-linearis_contig96.17042.1 ID=mRNA_C-linearis_contig96.17042.1|Name=mRNA_C-linearis_contig96.17042.1|organism=Chordaria linearis ClinC8C monoicous|type=CDS|length=216bp|location=Sequence derived from alignment at C-linearis_contig96:441279..441826+ (Chordaria linearis ClinC8C monoicous)back to top |