mRNA_C-linearis_contig94.16958.1 (mRNA) Chordaria linearis ClinC8C monoicous
You are viewing an mRNA, more information available on the corresponding polypeptide page
|
Overview
Homology
The following BLAST results are available for this feature:
BLAST of mRNA_C-linearis_contig94.16958.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 0 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_C-linearis_contig94.16958.1 >prot_C-linearis_contig94.16958.1 ID=prot_C-linearis_contig94.16958.1|Name=mRNA_C-linearis_contig94.16958.1|organism=Chordaria linearis ClinC8C monoicous|type=polypeptide|length=54bp TRHVYTDEERHRCNRIFRVPDIHSRKRVLVWRHPGDSGEAPQRLPVTILTback to top mRNA from alignment at C-linearis_contig94:662538..663374- Legend: polypeptideCDSUTR Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_C-linearis_contig94.16958.1 ID=mRNA_C-linearis_contig94.16958.1|Name=mRNA_C-linearis_contig94.16958.1|organism=Chordaria linearis ClinC8C monoicous|type=mRNA|length=837bp|location=Sequence derived from alignment at C-linearis_contig94:662538..663374- (Chordaria linearis ClinC8C monoicous)back to top Coding sequence (CDS) from alignment at C-linearis_contig94:662538..663374- >mRNA_C-linearis_contig94.16958.1 ID=mRNA_C-linearis_contig94.16958.1|Name=mRNA_C-linearis_contig94.16958.1|organism=Chordaria linearis ClinC8C monoicous|type=CDS|length=324bp|location=Sequence derived from alignment at C-linearis_contig94:662538..663374- (Chordaria linearis ClinC8C monoicous)back to top |