mRNA_C-linearis_contig101.705.1 (mRNA) Chordaria linearis ClinC8C monoicous
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_C-linearis_contig101.705.1 vs. uniprot
Match: D8LE05_ECTSI (Uncharacterized protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D8LE05_ECTSI) HSP 1 Score: 94.7 bits (234), Expect = 2.570e-23 Identity = 58/82 (70.73%), Postives = 65/82 (79.27%), Query Frame = 1 Query: 1 FNFVEYPPESKKLPSGTDIVKMMEERNAKRRAAAARAGVDAHLAAAGGA---PTSRTSDTTLDATAKVAPPATDSLREGDQT 237 F FVEYPPESKKLPSG +IV+MMEER AKRR AA R+G+DAHLAAAG PTSR +DTTLDATA V PP D+ RE DQ+ Sbjct: 33 FKFVEYPPESKKLPSGKEIVEMMEEREAKRRTAATRSGMDAHLAAAGAVTRTPTSRRTDTTLDATATV-PPTPDASREVDQS 113 The following BLAST results are available for this feature:
BLAST of mRNA_C-linearis_contig101.705.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_C-linearis_contig101.705.1 >prot_C-linearis_contig101.705.1 ID=prot_C-linearis_contig101.705.1|Name=mRNA_C-linearis_contig101.705.1|organism=Chordaria linearis ClinC8C monoicous|type=polypeptide|length=79bp FNFVEYPPESKKLPSGTDIVKMMEERNAKRRAAAARAGVDAHLAAAGGAPback to top mRNA from alignment at C-linearis_contig101:11499..11994- Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_C-linearis_contig101.705.1 ID=mRNA_C-linearis_contig101.705.1|Name=mRNA_C-linearis_contig101.705.1|organism=Chordaria linearis ClinC8C monoicous|type=mRNA|length=496bp|location=Sequence derived from alignment at C-linearis_contig101:11499..11994- (Chordaria linearis ClinC8C monoicous)back to top Coding sequence (CDS) from alignment at C-linearis_contig101:11499..11994- >mRNA_C-linearis_contig101.705.1 ID=mRNA_C-linearis_contig101.705.1|Name=mRNA_C-linearis_contig101.705.1|organism=Chordaria linearis ClinC8C monoicous|type=CDS|length=474bp|location=Sequence derived from alignment at C-linearis_contig101:11499..11994- (Chordaria linearis ClinC8C monoicous)back to top |