Homology
The following BLAST results are available for this feature:
BLAST of mRNA_A-nodosum_M_contig9908.2.1 vs. uniprot
Analysis Date: 2022-09-16 ( Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 0
Match Name | E-value | Identity | Description | |
back to top
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
None | No IPR available | GENE3D | 6.10.140.110 | | coord: 63..127 e-value: 2.6E-6 score: 29.6 |
IPR043822 | EsV-1-7 cysteine-rich motif | PFAM | PF19114 | EsV_1_7_cys | coord: 9..43 e-value: 3.3E-7 score: 30.8 coord: 47..81 e-value: 2.2E-9 score: 37.7 coord: 95..118 e-value: 0.063 score: 13.9 |
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_A-nodosum_M_contig9908.2.1 ID=prot_A-nodosum_M_contig9908.2.1|Name=mRNA_A-nodosum_M_contig9908.2.1|organism=Ascophyllum nodosum dioecious|type=polypeptide|length=134bp MVNVRNRICRTDGCGKYALFGVAGTKAAEYCTQHAPDGMVNVRSRMCSIE GCGKKASFGVAGAKRAEYCTQHAPDGMVNVKKSKCITEGWGKESSFGAKG TKTAECCTQHAPDGTTNVITRKCRTKDCCKQASF back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
Term | Definition |
IPR043822 | EsV_1_7_cys |
|