Homology
The following BLAST results are available for this feature:
BLAST of mRNA_A-nodosum_M_contig980.10.1 vs. uniprot
Analysis Date: 2022-09-16 ( Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 0
Match Name | E-value | Identity | Description | |
back to top
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
IPR036465 | von Willebrand factor A-like domain superfamily | GENE3D | 3.40.50.410 | von Willebrand factor, type A domain | coord: 1..75 e-value: 6.0E-8 score: 34.5 |
IPR036465 | von Willebrand factor A-like domain superfamily | SUPERFAMILY | 53300 | vWA-like | coord: 11..75 |
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_A-nodosum_M_contig980.10.1 ID=prot_A-nodosum_M_contig980.10.1|Name=mRNA_A-nodosum_M_contig980.10.1|organism=Ascophyllum nodosum dioecious|type=polypeptide|length=75bp MAKANSLLAANASTATYMFVITDGNGIVGDAPANALAAGTSIFVVGVGTI SEETLVAITGGSGVSYDVDDFDELD back to top
Annotated Terms
The following terms have been associated with this polypeptide:
Vocabulary: INTERPRO
Term | Definition |
IPR036465 | vWFA_dom_sf |
|