prot_A-nodosum_M_contig9.92.1 (polypeptide) Ascophyllum nodosum dioecious
You are viewing a polypeptide, more information available on the corresponding mRNA page
Overview
Homology
BLAST of mRNA_A-nodosum_M_contig9.92.1 vs. uniprot
Match: A0A6H5KAN7_9PHAE (Dimer_Tnp_hAT domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KAN7_9PHAE) HSP 1 Score: 105 bits (263), Expect = 6.470e-25 Identity = 52/79 (65.82%), Postives = 62/79 (78.48%), Query Frame = 0 Query: 4 EDLTAEAQQVRRVLLSKLAKKELGTARMPVERICALLDPRRKDCSDDHFINGGEPLKTSAIADVKNVAKTFVDPSNGPA 82 +DL E +VR V+LS++ KKELG ARMP+ERICALLDPRRKDCSD+H +NG LK SAIADVK+VAKTF + G A Sbjct: 227 DDLMTETCKVREVVLSRMEKKELGAARMPLERICALLDPRRKDCSDEHLVNGSADLKASAIADVKSVAKTFAEADLGSA 305
BLAST of mRNA_A-nodosum_M_contig9.92.1 vs. uniprot
Match: A0A6H5KJ52_9PHAE (Dimer_Tnp_hAT domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KJ52_9PHAE) HSP 1 Score: 105 bits (263), Expect = 9.310e-25 Identity = 52/79 (65.82%), Postives = 62/79 (78.48%), Query Frame = 0 Query: 4 EDLTAEAQQVRRVLLSKLAKKELGTARMPVERICALLDPRRKDCSDDHFINGGEPLKTSAIADVKNVAKTFVDPSNGPA 82 +DL E +VR V+LS++ KKELG ARMP+ERICALLDPRRKDCSD+H +NG LK SAIADVK+VAKTF + G A Sbjct: 555 DDLMTETCKVREVVLSRMEKKELGAARMPLERICALLDPRRKDCSDEHLVNGSADLKASAIADVKSVAKTFAEADLGSA 633
BLAST of mRNA_A-nodosum_M_contig9.92.1 vs. uniprot
Match: A0A6H5KDJ6_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KDJ6_9PHAE) HSP 1 Score: 68.9 bits (167), Expect = 8.800e-12 Identity = 42/84 (50.00%), Postives = 51/84 (60.71%), Query Frame = 0 Query: 4 EDLTAEAQQVRRVLLSKLAKKELGTARMPVERICALLDPRRKDCSDDHFINGGEPLKTSAIADVKNVAKTF----VDPSNGPAP 83 EDLT EAQ VR+VLL + +K +G A VER+ ALLDPRRKD NG E L+ +A AD+K TF V P+ PAP Sbjct: 252 EDLTTEAQGVRKVLLEVMEEKGVGKALQRVERLSALLDPRRKDLDATQVGNGDEDLRIAAEADLKKFIATFTAESVPPTPAPAP 335
BLAST of mRNA_A-nodosum_M_contig9.92.1 vs. uniprot
Match: A0A6H5JGG8_9PHAE (Dimer_Tnp_hAT domain-containing protein n=4 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JGG8_9PHAE) HSP 1 Score: 61.6 bits (148), Expect = 3.390e-9 Identity = 39/81 (48.15%), Postives = 50/81 (61.73%), Query Frame = 0 Query: 5 DLTAEAQQVRRVLLSKLAKKELGTARMPVERICALLDPRRKDCSDDHFINGGEPLKTSAIADVKNV-AKTFVDPSNG-PAP 83 DLTAEAQ V VL K+ +K +G+A++ VER+ AL+DPRRK D NG L+ A D+K V AK V P+ PAP Sbjct: 569 DLTAEAQCVLEVLQEKMREKGMGSAQVAVERLSALMDPRRKSLDSDQLENGSADLRKKAEDDLKAVIAKFDVGPATAAPAP 649
BLAST of mRNA_A-nodosum_M_contig9.92.1 vs. uniprot
Match: A0A6H5KFJ9_9PHAE (Fanconi-associated nuclease n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KFJ9_9PHAE) HSP 1 Score: 55.8 bits (133), Expect = 3.700e-7 Identity = 33/83 (39.76%), Postives = 48/83 (57.83%), Query Frame = 0 Query: 5 DLTAEAQQVRRVLLSKLAKKELGTARMPVERICALLDPRRKDCSDDHFINGGEPLKTSAIADVKNVAKTF----VDPSNGPAP 83 DL+ EAQ+V VLL + +K++ A VER+ AL+DPRRK + + NG L+ A D+K V F +P++ PAP Sbjct: 534 DLSLEAQEVLEVLLEVMGEKQVEKAVQQVERLSALMDPRRKSLNGEQLENGSAHLRKRAEEDLKAVIAQFDVQPSEPASAPAP 616
BLAST of mRNA_A-nodosum_M_contig9.92.1 vs. uniprot
Match: A0A6H5JR38_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JR38_9PHAE) HSP 1 Score: 55.1 bits (131), Expect = 6.600e-7 Identity = 34/75 (45.33%), Postives = 46/75 (61.33%), Query Frame = 0 Query: 5 DLTAEAQQVRRVLLSKLAKKELGTARMPVERICALLDPRRKDCSDDHFINGGEPLKTSAIADVKNV-AKTFVDPS 78 DLT EA+ V VLL + +K +G+A++ VER+ A++DPRRK D NG L+ A D+K V AK V PS Sbjct: 213 DLTVEARCVLEVLLDVMREKGVGSAQVAVERLAAVMDPRRKLLDSDQLENGSADLRKKAEDDLKAVIAKFDVGPS 287
BLAST of mRNA_A-nodosum_M_contig9.92.1 vs. uniprot
Match: A0A6H5JRT6_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JRT6_9PHAE) HSP 1 Score: 51.2 bits (121), Expect = 1.560e-5 Identity = 34/80 (42.50%), Postives = 45/80 (56.25%), Query Frame = 0 Query: 5 DLTAEAQQVRRVLLSKLAKKELGTARMPVERICALLDPRRKDCSDDHFINGGEPLKTSAIADVKNVAKTF-VDPSNGPAP 83 +L++ AQ V VLL + +K++G A VER+ AL+DPRRK NG L+ A D+K V F V PS PAP Sbjct: 558 ELSSAAQGVLEVLLDVMEEKQVGKAVQQVERLSALMDPRRKSLDGAKLENGSATLRKKAEEDLKAVIAQFDVQPSE-PAP 636 The following BLAST results are available for this feature:
BLAST of mRNA_A-nodosum_M_contig9.92.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 7 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_A-nodosum_M_contig9.92.1 ID=prot_A-nodosum_M_contig9.92.1|Name=mRNA_A-nodosum_M_contig9.92.1|organism=Ascophyllum nodosum dioecious|type=polypeptide|length=83bpback to top |