mRNA_A-nodosum_M_contig10279.4.1 (mRNA) Ascophyllum nodosum dioecious
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_A-nodosum_M_contig10279.4.1 vs. uniprot
Match: A0A6H5K8L9_9PHAE (Uncharacterized protein n=2 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K8L9_9PHAE) HSP 1 Score: 67.8 bits (164), Expect = 4.450e-10 Identity = 34/93 (36.56%), Postives = 52/93 (55.91%), Query Frame = -1 Query: 169 PDRPHVTEATFFWRYVSEHDLKEIMKRLAHLLVPSELERSGVDAITNIFITEASDTLRTNPVEPQCPMGYTMRMRGTETRELLDRYANILCAR 447 PDRPH+TE FFWRY+S + + +R+ +L+P+ ++R+GV+ + + I S TL+ E PMG M RG L + +L AR Sbjct: 132 PDRPHITEQRFFWRYISAVQMIALFERVTEVLLPNPVDRAGVNGLLHERIHSVSTTLQKLRQESHHPMGDHMSHRGKVAESLFREFVAVLSAR 224
BLAST of mRNA_A-nodosum_M_contig10279.4.1 vs. uniprot
Match: A0A6H5JFF6_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JFF6_9PHAE) HSP 1 Score: 63.5 bits (153), Expect = 1.380e-8 Identity = 33/93 (35.48%), Postives = 51/93 (54.84%), Query Frame = -1 Query: 169 PDRPHVTEATFFWRYVSEHDLKEIMKRLAHLLVPSELERSGVDAITNIFITEASDTLRTNPVEPQCPMGYTMRMRGTETRELLDRYANILCAR 447 PDRPHVTE FFWRY+S + + + + +L+P+ ++ +GV+ + + S TL+ E PMG+ MR R T L + +L AR Sbjct: 301 PDRPHVTEQRFFWRYISAVQMIALFEGVTEVLLPNPVDGAGVNGLLHERTHSISTTLQKLRQESHNPMGHHMRHRRTVAEGLFHEFVAVLSAR 393 The following BLAST results are available for this feature:
BLAST of mRNA_A-nodosum_M_contig10279.4.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_A-nodosum_M_contig10279.4.1 >prot_A-nodosum_M_contig10279.4.1 ID=prot_A-nodosum_M_contig10279.4.1|Name=mRNA_A-nodosum_M_contig10279.4.1|organism=Ascophyllum nodosum dioecious|type=polypeptide|length=134bp MDSLASRNSCRSSAFLAAWSDGVLWLLRAAMCVRELNFRLLLRGLRAHRMback to top mRNA from alignment at A-nodosum_M_contig10279:5053..5580- Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_A-nodosum_M_contig10279.4.1 ID=mRNA_A-nodosum_M_contig10279.4.1|Name=mRNA_A-nodosum_M_contig10279.4.1|organism=Ascophyllum nodosum dioecious|type=mRNA|length=528bp|location=Sequence derived from alignment at A-nodosum_M_contig10279:5053..5580- (Ascophyllum nodosum dioecious)back to top Coding sequence (CDS) from alignment at A-nodosum_M_contig10279:5053..5580- >mRNA_A-nodosum_M_contig10279.4.1 ID=mRNA_A-nodosum_M_contig10279.4.1|Name=mRNA_A-nodosum_M_contig10279.4.1|organism=Ascophyllum nodosum dioecious|type=CDS|length=402bp|location=Sequence derived from alignment at A-nodosum_M_contig10279:5053..5580- (Ascophyllum nodosum dioecious)back to top |