mRNA_A-nodosum_M_contig10273.8.1 (mRNA) Ascophyllum nodosum dioecious
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_A-nodosum_M_contig10273.8.1 vs. uniprot
Match: D7FNY3_ECTSI (DNA-directed RNA polymerase n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FNY3_ECTSI) HSP 1 Score: 71.6 bits (174), Expect = 8.220e-13 Identity = 36/46 (78.26%), Postives = 41/46 (89.13%), Query Frame = 3 Query: 99 STRRLLMVGLAEASAEKTMVRSHTGIRGAFVMETVSEGESGLAVQL 236 S RRLLMVGLAE++A KTMVRSH GIRGAFV+ET +G+SGLAVQL Sbjct: 450 SMRRLLMVGLAESAAAKTMVRSHKGIRGAFVVETTVDGKSGLAVQL 495
BLAST of mRNA_A-nodosum_M_contig10273.8.1 vs. uniprot
Match: A0A6H5KJ16_9PHAE (DNA-directed RNA polymerase subunit n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KJ16_9PHAE) HSP 1 Score: 69.3 bits (168), Expect = 5.500e-12 Identity = 35/46 (76.09%), Postives = 40/46 (86.96%), Query Frame = 3 Query: 99 STRRLLMVGLAEASAEKTMVRSHTGIRGAFVMETVSEGESGLAVQL 236 S RRLLMVGLAE++A KTMVRSH GIRGAFV++ EG+SGLAVQL Sbjct: 1679 SMRRLLMVGLAESAAAKTMVRSHKGIRGAFVVDMTVEGKSGLAVQL 1724 The following BLAST results are available for this feature:
BLAST of mRNA_A-nodosum_M_contig10273.8.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_A-nodosum_M_contig10273.8.1 >prot_A-nodosum_M_contig10273.8.1 ID=prot_A-nodosum_M_contig10273.8.1|Name=mRNA_A-nodosum_M_contig10273.8.1|organism=Ascophyllum nodosum dioecious|type=polypeptide|length=62bp MLTRIVVLEVDALHREYASPAHGGSSRSFCREDDGSIAYRHPRSLRHGDCback to top mRNA from alignment at A-nodosum_M_contig10273:14086..14845+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_A-nodosum_M_contig10273.8.1 ID=mRNA_A-nodosum_M_contig10273.8.1|Name=mRNA_A-nodosum_M_contig10273.8.1|organism=Ascophyllum nodosum dioecious|type=mRNA|length=760bp|location=Sequence derived from alignment at A-nodosum_M_contig10273:14086..14845+ (Ascophyllum nodosum dioecious)back to top Coding sequence (CDS) from alignment at A-nodosum_M_contig10273:14086..14845+ >mRNA_A-nodosum_M_contig10273.8.1 ID=mRNA_A-nodosum_M_contig10273.8.1|Name=mRNA_A-nodosum_M_contig10273.8.1|organism=Ascophyllum nodosum dioecious|type=CDS|length=186bp|location=Sequence derived from alignment at A-nodosum_M_contig10273:14086..14845+ (Ascophyllum nodosum dioecious)back to top |