Trimin1|161795|e_gw1.18.85.1 (polypeptide) Tribonema minus UTEX_B_3156
Overview
Homology
BLAST of jgi.p|Trimin1|161795 vs. uniprot
Match: A0A835Z7J4_9STRA (Uncharacterized protein (Fragment) n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835Z7J4_9STRA) HSP 1 Score: 87.0 bits (214), Expect = 2.990e-18 Identity = 38/38 (100.00%), Postives = 38/38 (100.00%), Query Frame = 0 Query: 1 MEHVTKRQCELCRKKPSFGREWLQPTRCSDHKEDDMDN 38 MEHVTKRQCELCRKKPSFGREWLQPTRCSDHKEDDMDN Sbjct: 1 MEHVTKRQCELCRKKPSFGREWLQPTRCSDHKEDDMDN 38
BLAST of jgi.p|Trimin1|161795 vs. uniprot
Match: A0A836CFL9_9STRA (Uncharacterized protein (Fragment) n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A836CFL9_9STRA) HSP 1 Score: 71.2 bits (173), Expect = 1.290e-11 Identity = 30/38 (78.95%), Postives = 34/38 (89.47%), Query Frame = 0 Query: 1 MEHVTKRQCELCRKKPSFGREWLQPTRCSDHKEDDMDN 38 MEHVT + CELCRK+PSFGREW QP RCSDHKEDDM++ Sbjct: 51 MEHVTGKHCELCRKQPSFGREWHQPLRCSDHKEDDMED 88 The following BLAST results are available for this feature:
BLAST of jgi.p|Trimin1|161795 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >Trimin1|161795|e_gw1.18.85.1 ID=Trimin1|161795|e_gw1.18.85.1|Name=jgi.p|Trimin1|161795|organism=Tribonema minus UTEX_B_3156 |type=polypeptide|length=179bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|