mRNA_S-firma_M_contig939.20368.1 (mRNA) Sphaerotrichia firma Sfir_13m male
|
Overview
Homology
The following BLAST results are available for this feature:
BLAST of mRNA_S-firma_M_contig939.20368.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Sphaerotrichia firma male vs UniRef90) Total hits: 0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_S-firma_M_contig939.20368.1 >prot_S-firma_M_contig939.20368.1 ID=prot_S-firma_M_contig939.20368.1|Name=mRNA_S-firma_M_contig939.20368.1|organism=Sphaerotrichia firma Sfir_13m male|type=polypeptide|length=107bp MSSVARRCLKKRPLVYAVLYTHHRPWWPWDGGFRASKQSRYSVGNAKGYDback to top mRNA from alignment at S-firma_M_contig939:24528..24851+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_S-firma_M_contig939.20368.1 ID=mRNA_S-firma_M_contig939.20368.1|Name=mRNA_S-firma_M_contig939.20368.1|organism=Sphaerotrichia firma Sfir_13m male|type=mRNA|length=324bp|location=Sequence derived from alignment at S-firma_M_contig939:24528..24851+ (Sphaerotrichia firma Sfir_13m male)back to top Coding sequence (CDS) from alignment at S-firma_M_contig939:24528..24851+ >mRNA_S-firma_M_contig939.20368.1 ID=mRNA_S-firma_M_contig939.20368.1|Name=mRNA_S-firma_M_contig939.20368.1|organism=Sphaerotrichia firma Sfir_13m male|type=CDS|length=642bp|location=Sequence derived from alignment at S-firma_M_contig939:24528..24851+ (Sphaerotrichia firma Sfir_13m male)back to top |