|
|
Homology
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterProScan on OGS1.0 of Sphaerotrichia firma female
Date Performed: 2022-09-29
| IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
|---|
| IPR003591 | Leucine-rich repeat, typical subtype | SMART | SM00369 | LRR_typ_2 | coord: 236..259
e-value: 0.47
score: 19.5
coord: 452..475
e-value: 8.3E-5
score: 32.0
coord: 356..379
e-value: 120.0
score: 4.3
coord: 284..307
e-value: 0.0098
score: 25.1
coord: 139..163
e-value: 0.25
score: 20.4
coord: 404..427
e-value: 0.0027
score: 27.0
coord: 90..113
e-value: 0.01
score: 25.0
coord: 164..187
e-value: 0.0034
score: 26.6
coord: 212..235
e-value: 8.2E-5
score: 32.0
coord: 188..211
e-value: 1.0E-4
score: 31.7
coord: 260..283
e-value: 150.0
score: 3.7
coord: 114..138
e-value: 4.6
score: 16.0
coord: 332..355
e-value: 3.0
score: 16.8
coord: 428..451
e-value: 0.039
score: 23.1
coord: 308..331
e-value: 0.0016
score: 27.7
coord: 70..89
e-value: 190.0
score: 2.9
coord: 380..403
e-value: 0.0046
score: 26.2 |
| None | No IPR available | SMART | SM00364 | LRR_bac_2 | coord: 404..423
e-value: 160.0
score: 4.6
coord: 114..134
e-value: 340.0
score: 2.0
coord: 188..207
e-value: 0.64
score: 19.1
coord: 332..351
e-value: 110.0
score: 5.7
coord: 452..471
e-value: 99.0
score: 6.1
coord: 380..399
e-value: 460.0
score: 1.1
coord: 139..159
e-value: 120.0
score: 5.6
coord: 308..327
e-value: 41.0
score: 9.0
coord: 476..496
e-value: 170.0
score: 4.4
coord: 164..183
e-value: 440.0
score: 1.2
coord: 212..231
e-value: 140.0
score: 5.0 |
| None | No IPR available | PANTHER | PTHR45617 | FAMILY NOT NAMED | coord: 38..212
coord: 359..495
coord: 311..452
coord: 142..270
coord: 191..366 |
| None | No IPR available | PHOBIUS | SIGNAL_PEPTIDE_H_REGION | Signal peptide H-region | coord: 4..15 |
| None | No IPR available | PHOBIUS | SIGNAL_PEPTIDE_C_REGION | Signal peptide C-region | coord: 16..20 |
| None | No IPR available | PHOBIUS | SIGNAL_PEPTIDE | Signal Peptide | coord: 1..20 |
| None | No IPR available | PHOBIUS | NON_CYTOPLASMIC_DOMAIN | Non cytoplasmic domain | coord: 21..568 |
| None | No IPR available | PHOBIUS | SIGNAL_PEPTIDE_N_REGION | Signal peptide N-region | coord: 1..3 |
| None | No IPR available | SIGNALP_EUK | SignalP-noTM | SignalP-noTM | coord: 1..21
score: 0.858 |
| None | No IPR available | SUPERFAMILY | 52058 | L domain-like | coord: 39..370 |
| None | No IPR available | SUPERFAMILY | 52058 | L domain-like | coord: 335..496 |
| IPR032675 | Leucine-rich repeat domain superfamily | GENE3D | 3.80.10.10 | | coord: 151..240
e-value: 5.5E-25
score: 89.5 |
| IPR032675 | Leucine-rich repeat domain superfamily | GENE3D | 3.80.10.10 | | coord: 36..150
e-value: 3.7E-20
score: 73.6 |
| IPR032675 | Leucine-rich repeat domain superfamily | GENE3D | 3.80.10.10 | | coord: 241..362
e-value: 4.4E-31
score: 109.5 |
| IPR032675 | Leucine-rich repeat domain superfamily | GENE3D | 3.80.10.10 | | coord: 363..509
e-value: 7.8E-33
score: 115.1 |
| IPR001611 | Leucine-rich repeat | PFAM | PF13855 | LRR_8 | coord: 406..465
e-value: 3.9E-13
score: 48.9
coord: 286..345
e-value: 1.1E-11
score: 44.3
coord: 69..126
e-value: 6.1E-12
score: 45.1
coord: 166..225
e-value: 2.4E-13
score: 49.6 |
| IPR001611 | Leucine-rich repeat | PROSITE | PS51450 | LRR | coord: 262..283
score: 5.055 |
| IPR001611 | Leucine-rich repeat | PROSITE | PS51450 | LRR | coord: 334..355
score: 4.793 |
| IPR001611 | Leucine-rich repeat | PROSITE | PS51450 | LRR | coord: 166..187
score: 6.11 |
| IPR001611 | Leucine-rich repeat | PROSITE | PS51450 | LRR | coord: 478..500
score: 4.824 |
| IPR001611 | Leucine-rich repeat | PROSITE | PS51450 | LRR | coord: 382..403
score: 6.072 |
| IPR001611 | Leucine-rich repeat | PROSITE | PS51450 | LRR | coord: 92..113
score: 5.748 |
| IPR001611 | Leucine-rich repeat | PROSITE | PS51450 | LRR | coord: 68..89
score: 5.302 |
| IPR001611 | Leucine-rich repeat | PROSITE | PS51450 | LRR | coord: 406..427
score: 6.257 |
| IPR001611 | Leucine-rich repeat | PROSITE | PS51450 | LRR | coord: 238..259
score: 5.617 |
| IPR001611 | Leucine-rich repeat | PROSITE | PS51450 | LRR | coord: 286..307
score: 5.725 |
| IPR001611 | Leucine-rich repeat | PROSITE | PS51450 | LRR | coord: 116..138
score: 4.801 |
| IPR001611 | Leucine-rich repeat | PROSITE | PS51450 | LRR | coord: 190..211
score: 7.08 |
| IPR001611 | Leucine-rich repeat | PROSITE | PS51450 | LRR | coord: 214..235
score: 6.434 |
| IPR001611 | Leucine-rich repeat | PROSITE | PS51450 | LRR | coord: 310..331
score: 6.095 |
| IPR001611 | Leucine-rich repeat | PROSITE | PS51450 | LRR | coord: 141..163
score: 5.094 |
| IPR001611 | Leucine-rich repeat | PROSITE | PS51450 | LRR | coord: 430..451
score: 5.987 |
| IPR001611 | Leucine-rich repeat | PROSITE | PS51450 | LRR | coord: 454..475
score: 7.258 |
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_S-firma_F_contig1057.779.1 ID=prot_S-firma_F_contig1057.779.1|Name=mRNA_S-firma_F_contig1057.779.1|organism=Sphaerotrichia firma ET2_F female|type=polypeptide|length=569bp
MRDFSPLVLAILAIVSGGTAAVNPCLDPENDAYRCRDTHLSLASCSITDD
DVRAGHLQACFEDCGSITIKTLNLAVNEVTTLPPATFDSLRGLLLLNLAS
NELTALPPDIFDSLQVLTELNLAGNDNLTALPAGIFDSLPALTTLNLQMN
KQLSTLPSGIFDHLQALTKLTLAGNNIRTLPLGIFDSLQALTTLNLGYNQ
LTELPSRIFDSLKALTTLDLGTNQLETLPPGIFDALQVLTRLILPHNRLK
TLSPGIFDSTPTLTSLNLFNNTVAPLPAGIFDSLEALTELFLGGNELASL
QSGTFDSLQAIETLGLSGNQLETLPPGIFDSFAAIRRLDVRDNKLATLPA
GIFDSCGVLTTLNLAGGSLTTLAPGIFGSLKGLRDLFLNDNELMSLPSGV
FDSLDNLNRLELEHNKLATLPAGIFDSLERLQLLYLHGNILSCLPPGVFD
LLKSLRRLYLSSNDLTTLPLGIFEPLQALIELSLNENPNLECLPTIPSIS
TKVTVDDGVGNACETPTAAMTVEETKEADVGEEAYRATITSVCCGSHWNC
VFFLTAQQTGATATIFRC* back to top
Annotated Terms
The following terms have been associated with this polypeptide:
|