mRNA_S-firma_F_contig10076.146.1 (mRNA) Sphaerotrichia firma ET2_F female
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_S-firma_F_contig10076.146.1 vs. uniprot
Match: A0A7S2CD11_9STRA (Hypothetical protein (Fragment) n=1 Tax=Florenciella parvula TaxID=236787 RepID=A0A7S2CD11_9STRA) HSP 1 Score: 58.2 bits (139), Expect = 5.970e-9 Identity = 28/58 (48.28%), Postives = 43/58 (74.14%), Query Frame = 1 Query: 1 EFLKEEGRTAEELFSDMKDAKENNYTALFEEHEYHGFVQSVLDAMEYKSFYHLMLAAA 174 +FL+ EG ++ E ++ KDA E+NYTALFEEH++H FV ++L +M Y+ F+ +M AA Sbjct: 96 QFLEGEGCSSAEFYAQCKDAIEDNYTALFEEHQHHWFVDALLASMSYEHFFEMMTKAA 153
BLAST of mRNA_S-firma_F_contig10076.146.1 vs. uniprot
Match: A0A7S4A6K5_9STRA (Hypothetical protein (Fragment) n=1 Tax=Pelagomonas calceolata TaxID=35677 RepID=A0A7S4A6K5_9STRA) HSP 1 Score: 53.5 bits (127), Expect = 2.880e-7 Identity = 27/57 (47.37%), Postives = 39/57 (68.42%), Query Frame = 1 Query: 4 FLKEEGRTAEELFSDMKDAKENNYTALFEEHEYHGFVQSVLDAMEYKSFYHLMLAAA 174 FL E+ + +E + ++DA E+ Y ALFEEHE+HG+V S A+ Y+ FY M+AAA Sbjct: 86 FLSEKAFSLQEFQAQLRDAVEDRYCALFEEHEHHGWVDSCFAAVSYEHFYRRMVAAA 142
BLAST of mRNA_S-firma_F_contig10076.146.1 vs. uniprot
Match: A0A7S3JYZ2_9STRA (Hypothetical protein (Fragment) n=1 Tax=Aureoumbra lagunensis TaxID=44058 RepID=A0A7S3JYZ2_9STRA) HSP 1 Score: 49.7 bits (117), Expect = 1.170e-5 Identity = 23/54 (42.59%), Postives = 36/54 (66.67%), Query Frame = 1 Query: 1 EFLKEEGRTAEELFSDMKDAKENNYTALFEEHEYHGFVQSVLDAMEYKSFYHLM 162 +FL + + +LF M+DAK + YTALFEEH++H +V S+L + ++ F LM Sbjct: 88 DFLHHQSLSMSQLFEQMEDAKLDRYTALFEEHQHHAWVDSILAVLSFEYFVQLM 141
BLAST of mRNA_S-firma_F_contig10076.146.1 vs. uniprot
Match: A0A7S2SCS0_9STRA (Hypothetical protein n=1 Tax=Rhizochromulina marina TaxID=1034831 RepID=A0A7S2SCS0_9STRA) HSP 1 Score: 48.5 bits (114), Expect = 2.800e-5 Identity = 23/58 (39.66%), Postives = 38/58 (65.52%), Query Frame = 1 Query: 1 EFLKEEGRTAEELFSDMKDAKENNYTALFEEHEYHGFVQSVLDAMEYKSFYHLMLAAA 174 +FL+ +G ++ + FS +DA E+ + LFEEH +H FV ++L +M Y+ F+ M AA Sbjct: 89 DFLRTQGCSSADFFSQCRDALEDRFVPLFEEHHHHWFVDALLSSMSYEHFFSSMCEAA 146 The following BLAST results are available for this feature:
BLAST of mRNA_S-firma_F_contig10076.146.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Sphaerotrichia firma female vs UniRef90) Total hits: 4 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_S-firma_F_contig10076.146.1 >prot_S-firma_F_contig10076.146.1 ID=prot_S-firma_F_contig10076.146.1|Name=mRNA_S-firma_F_contig10076.146.1|organism=Sphaerotrichia firma ET2_F female|type=polypeptide|length=64bp EFLKEEGRTAEELFSDMKDAKENNYTALFEEHEYHGFVQSVLDAMEYKSFback to top mRNA from alignment at S-firma_F_contig10076:2533..3248+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_S-firma_F_contig10076.146.1 ID=mRNA_S-firma_F_contig10076.146.1|Name=mRNA_S-firma_F_contig10076.146.1|organism=Sphaerotrichia firma ET2_F female|type=mRNA|length=716bp|location=Sequence derived from alignment at S-firma_F_contig10076:2533..3248+ (Sphaerotrichia firma ET2_F female)back to top Coding sequence (CDS) from alignment at S-firma_F_contig10076:2533..3248+ >mRNA_S-firma_F_contig10076.146.1 ID=mRNA_S-firma_F_contig10076.146.1|Name=mRNA_S-firma_F_contig10076.146.1|organism=Sphaerotrichia firma ET2_F female|type=CDS|length=384bp|location=Sequence derived from alignment at S-firma_F_contig10076:2533..3248+ (Sphaerotrichia firma ET2_F female)back to top |