|
|
Homology
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
| IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
| IPR013087 | Zinc finger C2H2-type | SMART | SM00355 | c2h2final6 | coord: 33..59 e-value: 4.4 score: 16.3 coord: 4..30 e-value: 0.25 score: 20.4 coord: 113..135 e-value: 46.0 score: 7.4 coord: 137..160 e-value: 0.84 score: 18.7 coord: 89..112 e-value: 3.0 score: 16.9 coord: 61..87 e-value: 3.4 score: 16.7 |
| IPR013087 | Zinc finger C2H2-type | PFAM | PF00096 | zf-C2H2 | coord: 63..81 e-value: 0.0011 score: 19.3 |
| IPR013087 | Zinc finger C2H2-type | PROSITE | PS00028 | ZINC_FINGER_C2H2_1 | coord: 139..160 |
| IPR013087 | Zinc finger C2H2-type | PROSITE | PS00028 | ZINC_FINGER_C2H2_1 | coord: 91..112 |
| IPR013087 | Zinc finger C2H2-type | PROSITE | PS00028 | ZINC_FINGER_C2H2_1 | coord: 114..135 |
| IPR013087 | Zinc finger C2H2-type | PROSITE | PS50157 | ZINC_FINGER_C2H2_2 | coord: 33..59 score: 9.390121 |
| IPR013087 | Zinc finger C2H2-type | PROSITE | PS50157 | ZINC_FINGER_C2H2_2 | coord: 4..30 score: 10.782589 |
| IPR013087 | Zinc finger C2H2-type | PROSITE | PS50157 | ZINC_FINGER_C2H2_2 | coord: 61..87 score: 9.369337 |
| IPR013087 | Zinc finger C2H2-type | PROSITE | PS50157 | ZINC_FINGER_C2H2_2 | coord: 137..165 score: 8.517231 |
| IPR022755 | Zinc finger, double-stranded RNA binding | PFAM | PF12171 | zf-C2H2_jaz | coord: 35..55 e-value: 2.1E-5 score: 24.7 coord: 4..26 e-value: 2.8E-6 score: 27.4 |
| None | No IPR available | GENE3D | 3.30.160.60 | Classic Zinc Finger | coord: 62..113 e-value: 1.9E-7 score: 33.2 coord: 4..55 e-value: 4.6E-11 score: 44.8 |
| None | No IPR available | PANTHER | PTHR24409:SF320 | AZ2-RELATED | coord: 35..158 coord: 4..108 |
| None | No IPR available | PANTHER | PTHR24409 | ZINC FINGER PROTEIN 142 | coord: 35..158 coord: 4..108 |
| IPR036236 | Zinc finger C2H2 superfamily | SUPERFAMILY | 57667 | beta-beta-alpha zinc fingers | coord: 41..98 |
| IPR036236 | Zinc finger C2H2 superfamily | SUPERFAMILY | 57667 | beta-beta-alpha zinc fingers | coord: 4..53 |
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_P-littoralis_Contig63.19.1 ID=prot_P-littoralis_Contig63.19.1|Name=mRNA_P-littoralis_Contig63.19.1|organism=Pylaiella littoralis U1_48|type=polypeptide|length=174bp MSGFACDVCNKAFSTQQSLDQHTRSNPRSHEFKICDECHKTFSTQEALDQ HTRSNPRSHFKICDKCDKSFSTQEALDQHTRSNPRSHIIVCDNCRRRFKT LKEKKEHTDSRHMCKVCKDIFCDDIDMAQHQYDMHMNRCTHCGKIFDNKH SAVAHIMANHLESTKVDGVDSRG* back to top
Annotated Terms
The following terms have been associated with this polypeptide:
|