mRNA_P-littoralis_Contig102.20.1 (mRNA) Pylaiella littoralis U1_48
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_P-littoralis_Contig102.20.1 vs. uniprot
Match: A0A6H5JHP9_9PHAE (Autophagy protein 5 n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JHP9_9PHAE) HSP 1 Score: 89.4 bits (220), Expect = 2.410e-19 Identity = 44/57 (77.19%), Postives = 51/57 (89.47%), Query Frame = 1 Query: 1 PLEWWRLEAWEYPLLASLARRVLCIPAPQAQPERVFSSAGNVVTKSRSQLDPENLEL 171 PLEWWR++A EYP LASLARRVLCIPA QAQ ERVFSSAG VVTK+R+++DPEN+ L Sbjct: 480 PLEWWRVKAREYPKLASLARRVLCIPAFQAQSERVFSSAGLVVTKTRARMDPENVGL 536
BLAST of mRNA_P-littoralis_Contig102.20.1 vs. uniprot
Match: A0A6H5JWI1_9PHAE (Dimer_Tnp_hAT domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JWI1_9PHAE) HSP 1 Score: 75.5 bits (184), Expect = 9.250e-15 Identity = 36/61 (59.02%), Postives = 47/61 (77.05%), Query Frame = 1 Query: 1 PLEWWRLEAWEYPLLASLARRVLCIPAPQAQPERVFSSAGNVVTKSRSQLDPENLELTGLL 183 PL+WWR+ ++P LA+LARRVL IPA QA+ ER+FS AGN+VTK+R+ L P +EL LL Sbjct: 223 PLDWWRVRCADFPHLANLARRVLAIPATQAESERLFSCAGNIVTKNRNNLAPTTVELLVLL 283
BLAST of mRNA_P-littoralis_Contig102.20.1 vs. uniprot
Match: A0A1A8CIX7_9TELE (Dimer_Tnp_hAT domain-containing protein (Fragment) n=1 Tax=Nothobranchius kadleci TaxID=1051664 RepID=A0A1A8CIX7_9TELE) HSP 1 Score: 70.9 bits (172), Expect = 1.120e-14 Identity = 30/57 (52.63%), Postives = 44/57 (77.19%), Query Frame = 1 Query: 1 PLEWWRLEAWEYPLLASLARRVLCIPAPQAQPERVFSSAGNVVTKSRSQLDPENLEL 171 PLEWW++ A+ YP+LASLA+ LCIPA ERVFS+AG++V+ RS + PE++++ Sbjct: 23 PLEWWKVNAYAYPILASLAKAYLCIPATSVPSERVFSTAGDIVSAQRSLITPEHVDM 79
BLAST of mRNA_P-littoralis_Contig102.20.1 vs. uniprot
Match: A0A1X7UWF3_AMPQE (BED-type domain-containing protein n=2 Tax=Amphimedon queenslandica TaxID=400682 RepID=A0A1X7UWF3_AMPQE) HSP 1 Score: 71.6 bits (174), Expect = 4.070e-13 Identity = 31/57 (54.39%), Postives = 41/57 (71.93%), Query Frame = 1 Query: 1 PLEWWRLEAWEYPLLASLARRVLCIPAPQAQPERVFSSAGNVVTKSRSQLDPENLEL 171 PL WW ++ YP+L+ LAR+ LCIPA ERVFS+AGN+VTK R+ LDPE + + Sbjct: 559 PLAWWSTNSFRYPILSQLARKYLCIPATSVPSERVFSTAGNIVTKKRACLDPETVNM 615
BLAST of mRNA_P-littoralis_Contig102.20.1 vs. uniprot
Match: UPI001CF4EC83 (E3 SUMO-protein ligase ZBED1-like n=1 Tax=Bufo gargarizans TaxID=30331 RepID=UPI001CF4EC83) HSP 1 Score: 70.1 bits (170), Expect = 4.420e-13 Identity = 31/56 (55.36%), Postives = 41/56 (73.21%), Query Frame = 1 Query: 1 PLEWWRLEAWEYPLLASLARRVLCIPAPQAQPERVFSSAGNVVTKSRSQLDPENLE 168 PLEWWRL +P +ASLA++ LCIPA A ER FS++GN+VT+ RS L PE ++ Sbjct: 169 PLEWWRLHQANFPRMASLAKKYLCIPATSAPSERAFSTSGNIVTRHRSALKPETVD 224
BLAST of mRNA_P-littoralis_Contig102.20.1 vs. uniprot
Match: A0A1A7ZCN3_NOTFU (Dimer_Tnp_hAT domain-containing protein n=1 Tax=Nothobranchius furzeri TaxID=105023 RepID=A0A1A7ZCN3_NOTFU) HSP 1 Score: 67.0 bits (162), Expect = 4.890e-13 Identity = 28/57 (49.12%), Postives = 41/57 (71.93%), Query Frame = 1 Query: 1 PLEWWRLEAWEYPLLASLARRVLCIPAPQAQPERVFSSAGNVVTKSRSQLDPENLEL 171 PL+WW+ +P LASLA+ LC+PA ER+FSSAGN+V+K R+ L PE++++ Sbjct: 33 PLQWWKSNEARFPSLASLAKSYLCVPATSTPSERLFSSAGNIVSKKRTSLSPEHIDM 89
BLAST of mRNA_P-littoralis_Contig102.20.1 vs. uniprot
Match: UPI001BD4DD18 (E3 SUMO-protein ligase ZBED1-like n=1 Tax=Cheilinus undulatus TaxID=241271 RepID=UPI001BD4DD18) HSP 1 Score: 67.0 bits (162), Expect = 2.420e-12 Identity = 30/56 (53.57%), Postives = 39/56 (69.64%), Query Frame = 1 Query: 1 PLEWWRLEAWEYPLLASLARRVLCIPAPQAQPERVFSSAGNVVTKSRSQLDPENLE 168 PLEWW+ EYPLLA LA+R LC+P ERVFS+AG++VT RS L E+++ Sbjct: 102 PLEWWKEHHCEYPLLAKLAKRYLCVPGTSVSAERVFSTAGDIVTAQRSSLTTEHVD 157
BLAST of mRNA_P-littoralis_Contig102.20.1 vs. uniprot
Match: UPI001C04A074 (E3 SUMO-protein ligase ZBED1-like n=3 Tax=Melanotaenia boesemani TaxID=1250792 RepID=UPI001C04A074) HSP 1 Score: 69.3 bits (168), Expect = 2.650e-12 Identity = 31/56 (55.36%), Postives = 40/56 (71.43%), Query Frame = 1 Query: 1 PLEWWRLEAWEYPLLASLARRVLCIPAPQAQPERVFSSAGNVVTKSRSQLDPENLE 168 PL WW+ A EYPLLA LARR LC+P ERVFS+AG++VT RS L P++++ Sbjct: 553 PLTWWKAHAGEYPLLACLARRYLCVPGTSVSSERVFSTAGDIVTAQRSCLTPQHVD 608
BLAST of mRNA_P-littoralis_Contig102.20.1 vs. uniprot
Match: UPI0018ACE819 (E3 SUMO-protein ligase ZBED1-like n=1 Tax=Kryptolebias marmoratus TaxID=37003 RepID=UPI0018ACE819) HSP 1 Score: 66.2 bits (160), Expect = 2.860e-12 Identity = 29/56 (51.79%), Postives = 40/56 (71.43%), Query Frame = 1 Query: 1 PLEWWRLEAWEYPLLASLARRVLCIPAPQAQPERVFSSAGNVVTKSRSQLDPENLE 168 PL WW+ +EYPLL+ LA+R LCIP ERVFS+AG+++T RS L PE+++ Sbjct: 78 PLVWWKEHQYEYPLLSHLAKRYLCIPGTSVSSERVFSTAGDIITAQRSALLPEHVD 133
BLAST of mRNA_P-littoralis_Contig102.20.1 vs. uniprot
Match: A0A1A8HG22_9TELE (Dimer_Tnp_hAT domain-containing protein n=1 Tax=Nothobranchius korthausae TaxID=1143690 RepID=A0A1A8HG22_9TELE) HSP 1 Score: 64.7 bits (156), Expect = 2.950e-12 Identity = 29/56 (51.79%), Postives = 39/56 (69.64%), Query Frame = 1 Query: 1 PLEWWRLEAWEYPLLASLARRVLCIPAPQAQPERVFSSAGNVVTKSRSQLDPENLE 168 PL WWR+ +PLLA L++R LCIP ERVFS+AG+VVT RS L P++++ Sbjct: 32 PLNWWRVHEVTFPLLARLSKRYLCIPGTSVSAERVFSTAGDVVTAKRSTLKPQHVD 87 The following BLAST results are available for this feature:
BLAST of mRNA_P-littoralis_Contig102.20.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25 ZOOMx 1POSITION0
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-littoralis_Contig102.20.1 >prot_P-littoralis_Contig102.20.1 ID=prot_P-littoralis_Contig102.20.1|Name=mRNA_P-littoralis_Contig102.20.1|organism=Pylaiella littoralis U1_48|type=polypeptide|length=61bp PLEWWRLEAWEYPLLASLARRVLCIPAPQAQPERVFSSAGNVVTKSRSQLback to top mRNA from alignment at P-littoralis_Contig102:83634..83816+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-littoralis_Contig102.20.1 ID=mRNA_P-littoralis_Contig102.20.1|Name=mRNA_P-littoralis_Contig102.20.1|organism=Pylaiella littoralis U1_48|type=mRNA|length=183bp|location=Sequence derived from alignment at P-littoralis_Contig102:83634..83816+ (Pylaiella littoralis U1_48)back to top Coding sequence (CDS) from alignment at P-littoralis_Contig102:83634..83816+ >mRNA_P-littoralis_Contig102.20.1 ID=mRNA_P-littoralis_Contig102.20.1|Name=mRNA_P-littoralis_Contig102.20.1|organism=Pylaiella littoralis U1_48|type=CDS|length=183bp|location=Sequence derived from alignment at P-littoralis_Contig102:83634..83816+ (Pylaiella littoralis U1_48)back to top |