mRNA_P-littoralis_Contig1017.9.1 (mRNA) Pylaiella littoralis U1_48
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_P-littoralis_Contig1017.9.1 vs. uniprot
Match: A0A6H5KFA5_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KFA5_9PHAE) HSP 1 Score: 100 bits (248), Expect = 2.360e-25 Identity = 46/66 (69.70%), Postives = 51/66 (77.27%), Query Frame = 1 Query: 1 RLDWLGTLWAEVKGLPPTTHLIVACWTAYVDGLAALEHRKADTKTATAFTLTRFAGWGERLQTWIN 198 R WLG LW +VK LPPTT LI W +VDG+AALEHRKADTK ATAFTLTRFAGW RL+ WI+ Sbjct: 58 RRRWLGPLWKKVKDLPPTTRLIPDAWNGHVDGVAALEHRKADTKAATAFTLTRFAGWEGRLRAWIS 123
BLAST of mRNA_P-littoralis_Contig1017.9.1 vs. uniprot
Match: A0A6H5JIR5_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JIR5_9PHAE) HSP 1 Score: 98.6 bits (244), Expect = 8.000e-23 Identity = 46/66 (69.70%), Postives = 50/66 (75.76%), Query Frame = 1 Query: 1 RLDWLGTLWAEVKGLPPTTHLIVACWTAYVDGLAALEHRKADTKTATAFTLTRFAGWGERLQTWIN 198 RLDWLG LWA VKGL PT LI+A W +VDG AA+ HRKADTK ATAFTL RFA W RLQ WI+ Sbjct: 138 RLDWLGELWAVVKGLQPTADLILARWKGHVDGTAAVSHRKADTKAATAFTLARFADWPGRLQAWID 203
BLAST of mRNA_P-littoralis_Contig1017.9.1 vs. uniprot
Match: A0A6H5K4F6_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K4F6_9PHAE) HSP 1 Score: 84.7 bits (208), Expect = 4.290e-18 Identity = 40/66 (60.61%), Postives = 46/66 (69.70%), Query Frame = 1 Query: 1 RLDWLGTLWAEVKGLPPTTHLIVACWTAYVDGLAALEHRKADTKTATAFTLTRFAGWGERLQTWIN 198 R WLG LW +V+ L PTT LI W +VDG+AA EHRKADTK ATA TLT AGW RL+ WI+ Sbjct: 213 RRRWLGPLWKKVEDLAPTTRLISDAWNGHVDGVAAFEHRKADTKAATASTLTLNAGWEGRLRAWIS 278 The following BLAST results are available for this feature:
BLAST of mRNA_P-littoralis_Contig1017.9.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 3 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-littoralis_Contig1017.9.1 >prot_P-littoralis_Contig1017.9.1 ID=prot_P-littoralis_Contig1017.9.1|Name=mRNA_P-littoralis_Contig1017.9.1|organism=Pylaiella littoralis U1_48|type=polypeptide|length=66bp RLDWLGTLWAEVKGLPPTTHLIVACWTAYVDGLAALEHRKADTKTATAFTback to top mRNA from alignment at P-littoralis_Contig1017:4275..4474- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-littoralis_Contig1017.9.1 ID=mRNA_P-littoralis_Contig1017.9.1|Name=mRNA_P-littoralis_Contig1017.9.1|organism=Pylaiella littoralis U1_48|type=mRNA|length=200bp|location=Sequence derived from alignment at P-littoralis_Contig1017:4275..4474- (Pylaiella littoralis U1_48)back to top Coding sequence (CDS) from alignment at P-littoralis_Contig1017:4275..4474- >mRNA_P-littoralis_Contig1017.9.1 ID=mRNA_P-littoralis_Contig1017.9.1|Name=mRNA_P-littoralis_Contig1017.9.1|organism=Pylaiella littoralis U1_48|type=CDS|length=198bp|location=Sequence derived from alignment at P-littoralis_Contig1017:4275..4474- (Pylaiella littoralis U1_48)back to top |