mRNA_P-littoralis_Contig10.111.1 (mRNA) Pylaiella littoralis U1_48
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
The following BLAST results are available for this feature:
BLAST of mRNA_P-littoralis_Contig10.111.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 0 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-littoralis_Contig10.111.1 >prot_P-littoralis_Contig10.111.1 ID=prot_P-littoralis_Contig10.111.1|Name=mRNA_P-littoralis_Contig10.111.1|organism=Pylaiella littoralis U1_48|type=polypeptide|length=183bp MYTYDMILFFCRVFQVFVFFYRSDCCGAQAYLLDFRRLCWFGCGLLAACSback to top mRNA from alignment at P-littoralis_Contig10:456595..457575+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-littoralis_Contig10.111.1 ID=mRNA_P-littoralis_Contig10.111.1|Name=mRNA_P-littoralis_Contig10.111.1|organism=Pylaiella littoralis U1_48|type=mRNA|length=981bp|location=Sequence derived from alignment at P-littoralis_Contig10:456595..457575+ (Pylaiella littoralis U1_48)back to top Coding sequence (CDS) from alignment at P-littoralis_Contig10:456595..457575+ >mRNA_P-littoralis_Contig10.111.1 ID=mRNA_P-littoralis_Contig10.111.1|Name=mRNA_P-littoralis_Contig10.111.1|organism=Pylaiella littoralis U1_48|type=CDS|length=549bp|location=Sequence derived from alignment at P-littoralis_Contig10:456595..457575+ (Pylaiella littoralis U1_48)back to top |