mRNA_P-lacustris_contig1000.121.1 (mRNA) Pleurocladia lacustris SAG_25_93
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_P-lacustris_contig1000.121.1 vs. uniprot
Match: D7G824_ECTSI (PDZ domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G824_ECTSI) HSP 1 Score: 56.2 bits (134), Expect = 8.560e-8 Identity = 29/52 (55.77%), Postives = 33/52 (63.46%), Query Frame = 2 Query: 2 KVLRDEFLPIFDGESHVSKTGANHHSGSSSPRAALCQRNPLLKCAALFWLGQ 157 K+LRDE LP+FDGE+ T S SSP QRNP L+CA LFWLGQ Sbjct: 2018 KLLRDELLPVFDGETGDGPTQGQQRS--SSP----LQRNPFLECATLFWLGQ 2063
BLAST of mRNA_P-lacustris_contig1000.121.1 vs. uniprot
Match: A0A6H5K928_9PHAE (PDZ domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K928_9PHAE) HSP 1 Score: 54.7 bits (130), Expect = 3.000e-7 Identity = 26/52 (50.00%), Postives = 31/52 (59.62%), Query Frame = 2 Query: 2 KVLRDEFLPIFDGESHVSKTGANHHSGSSSPRAALCQRNPLLKCAALFWLGQ 157 K+LRDE LP+FDGE+ T S + QRNP L+CA LFWLGQ Sbjct: 2110 KLLRDELLPVFDGETEHGPTQGQQRS------SFRLQRNPFLECATLFWLGQ 2155 The following BLAST results are available for this feature:
BLAST of mRNA_P-lacustris_contig1000.121.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-lacustris_contig1000.121.1 >prot_P-lacustris_contig1000.121.1 ID=prot_P-lacustris_contig1000.121.1|Name=mRNA_P-lacustris_contig1000.121.1|organism=Pleurocladia lacustris SAG_25_93|type=polypeptide|length=56bp EGASGRVLADFRRRESRFQDRREPPQRQQLTPSRPLPAQPVTKVRRPVLAback to top mRNA from alignment at P-lacustris_contig1000:47195..47713+ Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-lacustris_contig1000.121.1 ID=mRNA_P-lacustris_contig1000.121.1|Name=mRNA_P-lacustris_contig1000.121.1|organism=Pleurocladia lacustris SAG_25_93|type=mRNA|length=519bp|location=Sequence derived from alignment at P-lacustris_contig1000:47195..47713+ (Pleurocladia lacustris SAG_25_93)back to top Coding sequence (CDS) from alignment at P-lacustris_contig1000:47195..47713+ >mRNA_P-lacustris_contig1000.121.1 ID=mRNA_P-lacustris_contig1000.121.1|Name=mRNA_P-lacustris_contig1000.121.1|organism=Pleurocladia lacustris SAG_25_93|type=CDS|length=336bp|location=Sequence derived from alignment at P-lacustris_contig1000:47195..47713+ (Pleurocladia lacustris SAG_25_93)back to top |