mRNA_P-wetherbeei_contig9937.1.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig9937.1.1 vs. uniprot
Match: A0A0M9YNM0_9ACTN (Endonuclease VII n=1 Tax=Streptomyces sp. WM4235 TaxID=1415551 RepID=A0A0M9YNM0_9ACTN) HSP 1 Score: 52.4 bits (124), Expect = 3.500e-5 Identity = 30/90 (33.33%), Postives = 50/90 (55.56%), Query Frame = 1 Query: 43 VEKLCKSCDTNKPTSAFNKDKTHSDGLRSSCKSCAK---KALANPNRRRIVH-VARPPGQKRCPKCRNNKPHEAFSPDITSKDGFHAHCK 300 + K C C ++P S + +++ +DGL+S +SC+ KA R + V P G KRCP+CR KPH + + T+ DG+ ++C+ Sbjct: 4 ITKRCSRCKQDRPRSEYASNRSIADGLQSYGRSCSADYYKARQEAKGRTVREKVTVPSGHKRCPQCREVKPHSEWERNKTTSDGWSSYCR 93 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig9937.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig9937.1.1 >prot_P-wetherbeei_contig9937.1.1 ID=prot_P-wetherbeei_contig9937.1.1|Name=mRNA_P-wetherbeei_contig9937.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=172bp MEQRTSDPDESESLVEKLCKSCDTNKPTSAFNKDKTHSDGLRSSCKSCAKback to top mRNA from alignment at P-wetherbeei_contig9937:1835..2350+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig9937.1.1 ID=mRNA_P-wetherbeei_contig9937.1.1|Name=mRNA_P-wetherbeei_contig9937.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=516bp|location=Sequence derived from alignment at P-wetherbeei_contig9937:1835..2350+ (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig9937:1835..2350+ >mRNA_P-wetherbeei_contig9937.1.1 ID=mRNA_P-wetherbeei_contig9937.1.1|Name=mRNA_P-wetherbeei_contig9937.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=516bp|location=Sequence derived from alignment at P-wetherbeei_contig9937:1835..2350+ (Phaeothamnion wetherbeei SAG_119_79)back to top |