prot_P-wetherbeei_contig9933.1.1 (polypeptide) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig9933.1.1 vs. uniprot
Match: A0A523P222_9PROT (Ferrous iron transport protein A n=1 Tax=Proteobacteria bacterium TaxID=1977087 RepID=A0A523P222_9PROT) HSP 1 Score: 80.1 bits (196), Expect = 2.750e-18 Identity = 37/65 (56.92%), Postives = 49/65 (75.38%), Query Frame = 0 Query: 4 TLASLRPGEVGVVQGFAEIDETAQRLMQMGMVEGMEVEVLRYAPAGDPIEVRVLGYALSLRVSRS 68 +LASL+ G+ G V GF D QRLMQ+G++EG V+V+R APAGDPIE+R+LGY LSLR + + Sbjct: 3 SLASLKAGQTGTVSGFTREDIVTQRLMQLGVLEGATVDVVRRAPAGDPIEIRILGYMLSLRTAEA 67
BLAST of mRNA_P-wetherbeei_contig9933.1.1 vs. uniprot
Match: A0A3D5DCA6_9GAMM (Ferrous iron transport protein A n=1 Tax=Gammaproteobacteria bacterium TaxID=1913989 RepID=A0A3D5DCA6_9GAMM) HSP 1 Score: 76.6 bits (187), Expect = 6.140e-17 Identity = 33/64 (51.56%), Postives = 50/64 (78.12%), Query Frame = 0 Query: 1 MSTTLASLRPGEVGVVQGFAEIDETAQRLMQMGMVEGMEVEVLRYAPAGDPIEVRVLGYALSLR 64 M+ LA+L G+ ++GF++ + QRL+Q+G++EG V+V+R APAGDPIE+R+LGY+LSLR Sbjct: 1 MTQPLATLTAGQTATIRGFSQDNSVTQRLLQLGIIEGERVDVVRRAPAGDPIEIRILGYSLSLR 64
BLAST of mRNA_P-wetherbeei_contig9933.1.1 vs. uniprot
Match: A0A1Z9UHR8_9GAMM (FeoA domain-containing protein n=2 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A1Z9UHR8_9GAMM) HSP 1 Score: 75.1 bits (183), Expect = 2.430e-16 Identity = 34/64 (53.12%), Postives = 48/64 (75.00%), Query Frame = 0 Query: 1 MSTTLASLRPGEVGVVQGFAEIDETAQRLMQMGMVEGMEVEVLRYAPAGDPIEVRVLGYALSLR 64 MST L+ L G+ GVV GF + RLMQ+G++EG+++EV+R AP+GDPIE+ + GYALS+R Sbjct: 1 MSTPLSELAVGQAGVVLGFKYENNMTDRLMQLGIIEGVQIEVIRVAPSGDPIELDIAGYALSMR 64
BLAST of mRNA_P-wetherbeei_contig9933.1.1 vs. uniprot
Match: A0A2E2BC22_9GAMM (Ferrous iron transport protein A n=1 Tax=Thiotrichales bacterium TaxID=2026796 RepID=A0A2E2BC22_9GAMM) HSP 1 Score: 72.8 bits (177), Expect = 1.990e-15 Identity = 34/64 (53.12%), Postives = 47/64 (73.44%), Query Frame = 0 Query: 1 MSTTLASLRPGEVGVVQGFAEIDETAQRLMQMGMVEGMEVEVLRYAPAGDPIEVRVLGYALSLR 64 MST L L G+ GVV GF + RLMQ+G++EG+E++V+R AP+GDPIE+ + GYALS+R Sbjct: 1 MSTPLXELAVGQSGVVLGFKYENNMTXRLMQLGIIEGVEIKVIRVAPSGDPIELDIAGYALSMR 64
BLAST of mRNA_P-wetherbeei_contig9933.1.1 vs. uniprot
Match: A0A7W1UJ76_9BACT (Ferrous iron transport protein A n=1 Tax=Gemmatimonadetes bacterium TaxID=2026742 RepID=A0A7W1UJ76_9BACT) HSP 1 Score: 72.4 bits (176), Expect = 2.760e-15 Identity = 35/64 (54.69%), Postives = 45/64 (70.31%), Query Frame = 0 Query: 1 MSTTLASLRPGEVGVVQGFAEIDETAQRLMQMGMVEGMEVEVLRYAPAGDPIEVRVLGYALSLR 64 MS TLA LRPGE G VQ A E +RLM +G++ G +EV+R AP GDP+EVR+ G+ L+LR Sbjct: 1 MSRTLAQLRPGERGRVQAIAGDHEATRRLMDLGLIRGTTLEVIRVAPLGDPLEVRLRGFMLTLR 64
BLAST of mRNA_P-wetherbeei_contig9933.1.1 vs. uniprot
Match: A0A7X4ZDW3_9CLOT (Ferrous iron transport protein A n=2 Tax=Clostridiaceae bacterium TaxID=1898204 RepID=A0A7X4ZDW3_9CLOT) HSP 1 Score: 68.2 bits (165), Expect = 1.240e-13 Identity = 31/61 (50.82%), Postives = 43/61 (70.49%), Query Frame = 0 Query: 4 TLASLRPGEVGVVQGFAEIDETAQRLMQMGMVEGMEVEVLRYAPAGDPIEVRVLGYALSLR 64 TL L+PG+ G+V+ A + +R+M MG+ G+EV+V++ AP GDPIEV V GY LSLR Sbjct: 2 TLKDLKPGQEGIVKSIATVGAMKRRIMDMGITPGVEVKVIKAAPLGDPIEVHVRGYELSLR 62
BLAST of mRNA_P-wetherbeei_contig9933.1.1 vs. uniprot
Match: A0A1M5V4A3_9CLOT (Ferrous iron transport protein A n=1 Tax=Clostridium grantii DSM 8605 TaxID=1121316 RepID=A0A1M5V4A3_9CLOT) HSP 1 Score: 68.2 bits (165), Expect = 1.300e-13 Identity = 30/68 (44.12%), Postives = 46/68 (67.65%), Query Frame = 0 Query: 1 MSTTLASLRPGEVGVVQGFAEIDETAQRLMQMGMVEGMEVEVLRYAPAGDPIEVRVLGYALSLRVSRS 68 M TL L+PG+ G+++ + + +RLM+MG+ +G EV + + AP GDPIE++V GY LSLR S + Sbjct: 1 MERTLEQLKPGDRGIIKSIGGLGKVRRRLMEMGVTKGTEVNIEKVAPLGDPIEIKVKGYNLSLRKSEA 68
BLAST of mRNA_P-wetherbeei_contig9933.1.1 vs. uniprot
Match: A0A6L7YSA7_9BACT (Ferrous iron transport protein A n=1 Tax=Rhodothermaceae bacterium TaxID=2026787 RepID=A0A6L7YSA7_9BACT) HSP 1 Score: 68.2 bits (165), Expect = 1.340e-13 Identity = 34/61 (55.74%), Postives = 44/61 (72.13%), Query Frame = 0 Query: 4 TLASLRPGEVGVVQGFAEIDETAQRLMQMGMVEGMEVEVLRYAPAGDPIEVRVLGYALSLR 64 TL LRPGE G + GF E D RLM+MGM+ G EV+V+R AP GDP++++V GY LS+R Sbjct: 2 TLQDLRPGESGRILGF-EPDAVMDRLMEMGMLPGSEVQVVRLAPLGDPMDLKVRGYHLSIR 61
BLAST of mRNA_P-wetherbeei_contig9933.1.1 vs. uniprot
Match: A0A0S8BZ27_9DELT (FeoA domain-containing protein n=1 Tax=Myxococcales bacterium SG8_38 TaxID=1703407 RepID=A0A0S8BZ27_9DELT) HSP 1 Score: 68.2 bits (165), Expect = 1.440e-13 Identity = 33/64 (51.56%), Postives = 45/64 (70.31%), Query Frame = 0 Query: 1 MSTTLASLRPGEVGVVQGFAEIDETAQRLMQMGMVEGMEVEVLRYAPAGDPIEVRVLGYALSLR 64 M+ +LA LRPG+ G + A+RLM+MG++ G EV V+R AP GDP+E+RV GYALS+R Sbjct: 1 MTPSLADLRPGQTGEIVSIDCDRPIARRLMEMGLLPGTEVRVIRLAPLGDPLELRVRGYALSVR 64
BLAST of mRNA_P-wetherbeei_contig9933.1.1 vs. uniprot
Match: A0A1H9YW34_9FIRM (Ferrous iron transport protein A n=1 Tax=[Clostridium] polysaccharolyticum TaxID=29364 RepID=A0A1H9YW34_9FIRM) HSP 1 Score: 67.8 bits (164), Expect = 1.760e-13 Identity = 30/66 (45.45%), Postives = 44/66 (66.67%), Query Frame = 0 Query: 4 TLASLRPGEVGVVQGFAEIDETAQRLMQMGMVEGMEVEVLRYAPAGDPIEVRVLGYALSLRVSRSR 69 TL L+PG+ G+V E T +R+M MG+ G+ ++V++ AP GDP+EV V GY LSLR + +R Sbjct: 2 TLEDLKPGQEGIVASLGEKGATRRRIMDMGITPGVSIKVIKIAPLGDPVEVNVRGYELSLRKAEAR 67 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig9933.1.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topInterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_P-wetherbeei_contig9933.1.1 ID=prot_P-wetherbeei_contig9933.1.1|Name=mRNA_P-wetherbeei_contig9933.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=70bpback to top |