prot_P-wetherbeei_contig12187.1.1 (polypeptide) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig12187.1.1 vs. uniprot
Match: A0A259MWH4_9PROT (NADH-quinone oxidoreductase subunit I n=11 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A259MWH4_9PROT) HSP 1 Score: 85.5 bits (210), Expect = 6.120e-20 Identity = 41/44 (93.18%), Postives = 43/44 (97.73%), Query Frame = 0 Query: 1 MASLDRTARAFLLTELVTGFALTLKYMFKPKVTVNYPHEKGPLS 44 MASLDRTARAFLLTEL+ GFALTLKYMFKPKVTVNYP+EKGPLS Sbjct: 1 MASLDRTARAFLLTELLAGFALTLKYMFKPKVTVNYPYEKGPLS 44
BLAST of mRNA_P-wetherbeei_contig12187.1.1 vs. uniprot
Match: A0A1H8XGF3_9PROT (NADH-quinone oxidoreductase subunit I n=2 Tax=unclassified Rhodospirillales TaxID=941843 RepID=A0A1H8XGF3_9PROT) HSP 1 Score: 81.3 bits (199), Expect = 2.780e-18 Identity = 39/44 (88.64%), Postives = 42/44 (95.45%), Query Frame = 0 Query: 1 MASLDRTARAFLLTELVTGFALTLKYMFKPKVTVNYPHEKGPLS 44 MASLDRTAR+FLL+ELV GF LTLKYMFKPKVTVNYP+EKGPLS Sbjct: 1 MASLDRTARSFLLSELVGGFLLTLKYMFKPKVTVNYPYEKGPLS 44
BLAST of mRNA_P-wetherbeei_contig12187.1.1 vs. uniprot
Match: A0A5C8PPP5_9HYPH (NADH-quinone oxidoreductase subunit I n=1 Tax=Vineibacter terrae TaxID=2586908 RepID=A0A5C8PPP5_9HYPH) HSP 1 Score: 80.5 bits (197), Expect = 5.560e-18 Identity = 38/44 (86.36%), Postives = 41/44 (93.18%), Query Frame = 0 Query: 1 MASLDRTARAFLLTELVTGFALTLKYMFKPKVTVNYPHEKGPLS 44 MA LDRTARAFLLTE+++GF LTLKYMFKPKVTVNYP EKGPLS Sbjct: 1 MAFLDRTARAFLLTEVISGFVLTLKYMFKPKVTVNYPFEKGPLS 44
BLAST of mRNA_P-wetherbeei_contig12187.1.1 vs. uniprot
Match: NUOI_MAGSA (NADH-quinone oxidoreductase subunit I n=17 Tax=Rhodospirillaceae TaxID=41295 RepID=NUOI_MAGSA) HSP 1 Score: 79.0 bits (193), Expect = 2.220e-17 Identity = 37/44 (84.09%), Postives = 41/44 (93.18%), Query Frame = 0 Query: 1 MASLDRTARAFLLTELVTGFALTLKYMFKPKVTVNYPHEKGPLS 44 M+ LDRTARAFLLTELV G ALTL+YMFKPKVT+NYP+EKGPLS Sbjct: 1 MSFLDRTARAFLLTELVQGLALTLRYMFKPKVTINYPYEKGPLS 44
BLAST of mRNA_P-wetherbeei_contig12187.1.1 vs. uniprot
Match: A0A6N7AJV1_9PROT (NADH-quinone oxidoreductase subunit I n=1 Tax=Rhodospirillaceae bacterium TaxID=1898112 RepID=A0A6N7AJV1_9PROT) HSP 1 Score: 79.0 bits (193), Expect = 2.220e-17 Identity = 38/44 (86.36%), Postives = 40/44 (90.91%), Query Frame = 0 Query: 1 MASLDRTARAFLLTELVTGFALTLKYMFKPKVTVNYPHEKGPLS 44 MA LDRTARAFLLTELV G ALTL+YMFKPKVT+NYP EKGPLS Sbjct: 1 MAFLDRTARAFLLTELVQGMALTLRYMFKPKVTINYPFEKGPLS 44
BLAST of mRNA_P-wetherbeei_contig12187.1.1 vs. uniprot
Match: A0A199YGA0_9PROT (NADH-quinone oxidoreductase subunit I n=33 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A199YGA0_9PROT) HSP 1 Score: 77.0 bits (188), Expect = 1.260e-16 Identity = 35/44 (79.55%), Postives = 41/44 (93.18%), Query Frame = 0 Query: 1 MASLDRTARAFLLTELVTGFALTLKYMFKPKVTVNYPHEKGPLS 44 M+ +DRTAR+FLL ELV+G ALTLKYMFKPKVT+NYP+EKGPLS Sbjct: 1 MSFIDRTARSFLLAELVSGMALTLKYMFKPKVTINYPYEKGPLS 44
BLAST of mRNA_P-wetherbeei_contig12187.1.1 vs. uniprot
Match: A0A1G6XNL8_9PROT (NADH-quinone oxidoreductase subunit I n=15 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A1G6XNL8_9PROT) HSP 1 Score: 76.6 bits (187), Expect = 1.780e-16 Identity = 36/44 (81.82%), Postives = 40/44 (90.91%), Query Frame = 0 Query: 1 MASLDRTARAFLLTELVTGFALTLKYMFKPKVTVNYPHEKGPLS 44 MASLDR AR+ LLTELV+G ALTLKY FKPKVTVNYP+EKGP+S Sbjct: 1 MASLDRAARSLLLTELVSGMALTLKYFFKPKVTVNYPYEKGPIS 44
BLAST of mRNA_P-wetherbeei_contig12187.1.1 vs. uniprot
Match: A0A537MZ06_9PROT (NADH-quinone oxidoreductase subunit I n=1 Tax=Alphaproteobacteria bacterium TaxID=1913988 RepID=A0A537MZ06_9PROT) HSP 1 Score: 76.3 bits (186), Expect = 2.510e-16 Identity = 34/44 (77.27%), Postives = 41/44 (93.18%), Query Frame = 0 Query: 1 MASLDRTARAFLLTELVTGFALTLKYMFKPKVTVNYPHEKGPLS 44 MA+LDRTAR+FLLTELV+GF LTL+YMFKPK T+NYP+E+ PLS Sbjct: 1 MATLDRTARSFLLTELVSGFMLTLRYMFKPKATINYPYERSPLS 44
BLAST of mRNA_P-wetherbeei_contig12187.1.1 vs. uniprot
Match: A0A7X2FWS2_9PROT (NADH-quinone oxidoreductase subunit I n=1 Tax=Alphaproteobacteria bacterium HT1-32 TaxID=2665153 RepID=A0A7X2FWS2_9PROT) HSP 1 Score: 75.5 bits (184), Expect = 5.010e-16 Identity = 34/44 (77.27%), Postives = 41/44 (93.18%), Query Frame = 0 Query: 1 MASLDRTARAFLLTELVTGFALTLKYMFKPKVTVNYPHEKGPLS 44 MA LDRTAR+FLLTE+V+G A+TL+YMFKP VT+NYP+EKGPLS Sbjct: 1 MAFLDRTARSFLLTEIVSGMAITLRYMFKPSVTLNYPYEKGPLS 44
BLAST of mRNA_P-wetherbeei_contig12187.1.1 vs. uniprot
Match: A0A1T4KWZ2_9HYPH (NADH-quinone oxidoreductase subunit I n=1 Tax=Enhydrobacter aerosaccus TaxID=225324 RepID=A0A1T4KWZ2_9HYPH) HSP 1 Score: 74.7 bits (182), Expect = 1.000e-15 Identity = 34/44 (77.27%), Postives = 39/44 (88.64%), Query Frame = 0 Query: 1 MASLDRTARAFLLTELVTGFALTLKYMFKPKVTVNYPHEKGPLS 44 M SLDR AR FLL E+++GFALTLKYMFKPKVTVNYP+E+ PLS Sbjct: 1 MPSLDRAARTFLLAEVISGFALTLKYMFKPKVTVNYPYERSPLS 44 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig12187.1.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_P-wetherbeei_contig12187.1.1 ID=prot_P-wetherbeei_contig12187.1.1|Name=mRNA_P-wetherbeei_contig12187.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=44bpback to top |