mRNA_P-wetherbeei_contig11099.1.1 (mRNA) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig11099.1.1 vs. uniprot
Match: A0A3D0CX13_9CHLR (Formate transporter n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A3D0CX13_9CHLR) HSP 1 Score: 51.2 bits (121), Expect = 1.120e-5 Identity = 32/71 (45.07%), Postives = 44/71 (61.97%), Query Frame = 1 Query: 25 EEAKKPGTEILEVQKREANAEFDRPVLGLSLSALSAGLDLGFSMFLVAVVSHLLVDS-PRPLREICLALSY 234 EE +KP ILE + E E +R GL ++ LSAGLD+GFS+FL+AV+ L+ RP+ EI +A Y Sbjct: 9 EEPRKPARRILEQEIMEGLGEIERSTSGLFMAGLSAGLDVGFSLFLMAVMLTLVTGMLARPIVEILVANMY 79
BLAST of mRNA_P-wetherbeei_contig11099.1.1 vs. uniprot
Match: A0A5C6CDI5_9BACT (Inner membrane protein YfdC n=1 Tax=Novipirellula galeiformis TaxID=2528004 RepID=A0A5C6CDI5_9BACT) HSP 1 Score: 50.1 bits (118), Expect = 2.940e-5 Identity = 30/70 (42.86%), Postives = 45/70 (64.29%), Query Frame = 1 Query: 28 EAKKPGTEILEVQKREANAEFDRPVLGLSLSALSAGLDLGFSMFLVAVVSHLLVDS-PRPLREICLALSY 234 E KKP +I+ + +EA A F R + L S LSAGL++GFS+FL+AV+ LL D P+ + ++ +A Y Sbjct: 21 EPKKPSQQIMRHELKEALAAFQRSSVRLFFSGLSAGLEIGFSLFLMAVMQTLLQDDLPKSVVDLLVANMY 90
BLAST of mRNA_P-wetherbeei_contig11099.1.1 vs. uniprot
Match: A0A830GJX3_9EURY (Formate dehydrogenase n=2 Tax=Haloarculaceae TaxID=1963268 RepID=A0A830GJX3_9EURY) HSP 1 Score: 49.7 bits (117), Expect = 3.950e-5 Identity = 26/45 (57.78%), Postives = 32/45 (71.11%), Query Frame = 1 Query: 40 PGTEILEVQKREANAEFDRPVLGLSLSALSAGLDLGFSMFLVAVV 174 P +IL++Q +E RPV GLSLSALSAGLD+GF L+AVV Sbjct: 15 PSEDILDIQIERGLSELRRPVTGLSLSALSAGLDIGFGPLLMAVV 59
BLAST of mRNA_P-wetherbeei_contig11099.1.1 vs. uniprot
Match: A0A8J8C6V5_9EURY (Formate/nitrite transporter family protein n=3 Tax=Halomicroarcula TaxID=1427149 RepID=A0A8J8C6V5_9EURY) HSP 1 Score: 49.3 bits (116), Expect = 5.430e-5 Identity = 25/44 (56.82%), Postives = 32/44 (72.73%), Query Frame = 1 Query: 43 GTEILEVQKREANAEFDRPVLGLSLSALSAGLDLGFSMFLVAVV 174 G +ILE+Q R +E +RP GLSLSALSAGLD+GF L+ V+ Sbjct: 17 GEDILELQIRRGLSELNRPTSGLSLSALSAGLDIGFGPLLMGVI 60
BLAST of mRNA_P-wetherbeei_contig11099.1.1 vs. uniprot
Match: A0A8J7YD11_9EURY (Formate/nitrite transporter family protein n=2 Tax=Halomicroarcula salinisoli TaxID=2487746 RepID=A0A8J7YD11_9EURY) HSP 1 Score: 48.9 bits (115), Expect = 7.350e-5 Identity = 27/50 (54.00%), Postives = 35/50 (70.00%), Query Frame = 1 Query: 25 EEAKKPGTEILEVQKREANAEFDRPVLGLSLSALSAGLDLGFSMFLVAVV 174 EEA+ G +IL++Q R +E RP GLSLSALSAGLD+GF L+ V+ Sbjct: 4 EEAQAEGEDILDIQIRRGLSELWRPTSGLSLSALSAGLDVGFGPLLMGVI 53
BLAST of mRNA_P-wetherbeei_contig11099.1.1 vs. uniprot
Match: UPI000AC04A3C (formate/nitrite transporter family protein n=1 Tax=Haladaptatus cibarius TaxID=453847 RepID=UPI000AC04A3C) HSP 1 Score: 48.9 bits (115), Expect = 7.400e-5 Identity = 33/78 (42.31%), Postives = 47/78 (60.26%), Query Frame = 1 Query: 4 SELEESPEEAKKPGTEILEVQKREANAEFDRPVLGLSLSALSAGLDLGFSMFLVAVVSHLLVDS-PRPLREICLALSY 234 +E+E+ P + +KP IL Q E E +RP GL LSALSAGLD+GF L+ V++ L+ S PL + +A +Y Sbjct: 9 AEIEDRPTDQQKPRESILASQIDEGLNELERPTNGLFLSALSAGLDIGFGPLLMVVLATLVGSSWGTPLTTLLIANAY 86 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig11099.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 6
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_P-wetherbeei_contig11099.1.1 >prot_P-wetherbeei_contig11099.1.1 ID=prot_P-wetherbeei_contig11099.1.1|Name=mRNA_P-wetherbeei_contig11099.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=78bp MSELEESPEEAKKPGTEILEVQKREANAEFDRPVLGLSLSALSAGLDLGFback to top mRNA from alignment at P-wetherbeei_contig11099:1977..2210+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_P-wetherbeei_contig11099.1.1 ID=mRNA_P-wetherbeei_contig11099.1.1|Name=mRNA_P-wetherbeei_contig11099.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=mRNA|length=234bp|location=Sequence derived from alignment at P-wetherbeei_contig11099:1977..2210+ (Phaeothamnion wetherbeei SAG_119_79)back to top Coding sequence (CDS) from alignment at P-wetherbeei_contig11099:1977..2210+ >mRNA_P-wetherbeei_contig11099.1.1 ID=mRNA_P-wetherbeei_contig11099.1.1|Name=mRNA_P-wetherbeei_contig11099.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=CDS|length=234bp|location=Sequence derived from alignment at P-wetherbeei_contig11099:1977..2210+ (Phaeothamnion wetherbeei SAG_119_79)back to top |