prot_P-wetherbeei_contig9425.1.1 (polypeptide) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig9425.1.1 vs. uniprot
Match: K8YQL4_NANGC (Ubiquitin-like domain-containing protein (Fragment) n=2 Tax=cellular organisms TaxID=131567 RepID=K8YQL4_NANGC) HSP 1 Score: 68.2 bits (165), Expect = 3.200e-13 Identity = 34/35 (97.14%), Postives = 35/35 (100.00%), Query Frame = 0 Query: 1 MQIFVKTLTGKTITLDVEPSDTIDNVKQKIQDKEG 35 MQIFVKTLTGKTITLDVEPSDTI+NVKQKIQDKEG Sbjct: 1 MQIFVKTLTGKTITLDVEPSDTIENVKQKIQDKEG 35
BLAST of mRNA_P-wetherbeei_contig9425.1.1 vs. uniprot
Match: A0A5J6VMF0_9VIRU (Ubiquitin family protein n=1 Tax=Megaviridae environmental sample TaxID=1737588 RepID=A0A5J6VMF0_9VIRU) HSP 1 Score: 69.7 bits (169), Expect = 3.440e-13 Identity = 35/35 (100.00%), Postives = 35/35 (100.00%), Query Frame = 0 Query: 1 MQIFVKTLTGKTITLDVEPSDTIDNVKQKIQDKEG 35 MQIFVKTLTGKTITLDVEPSDTIDNVKQKIQDKEG Sbjct: 1 MQIFVKTLTGKTITLDVEPSDTIDNVKQKIQDKEG 35
BLAST of mRNA_P-wetherbeei_contig9425.1.1 vs. uniprot
Match: A0A7S3JUM4_9STRA (Hypothetical protein n=1 Tax=Aureoumbra lagunensis TaxID=44058 RepID=A0A7S3JUM4_9STRA) HSP 1 Score: 69.7 bits (169), Expect = 4.310e-13 Identity = 35/35 (100.00%), Postives = 35/35 (100.00%), Query Frame = 0 Query: 1 MQIFVKTLTGKTITLDVEPSDTIDNVKQKIQDKEG 35 MQIFVKTLTGKTITLDVEPSDTIDNVKQKIQDKEG Sbjct: 15 MQIFVKTLTGKTITLDVEPSDTIDNVKQKIQDKEG 49
BLAST of mRNA_P-wetherbeei_contig9425.1.1 vs. uniprot
Match: A0A6C0BB35_9ZZZZ (Ubiquitin-like domain-containing protein n=1 Tax=viral metagenome TaxID=1070528 RepID=A0A6C0BB35_9ZZZZ) HSP 1 Score: 67.8 bits (164), Expect = 4.370e-13 Identity = 33/35 (94.29%), Postives = 35/35 (100.00%), Query Frame = 0 Query: 1 MQIFVKTLTGKTITLDVEPSDTIDNVKQKIQDKEG 35 MQIF+KTLTGKTITLDVEPSD+IDNVKQKIQDKEG Sbjct: 1 MQIFIKTLTGKTITLDVEPSDSIDNVKQKIQDKEG 35
BLAST of mRNA_P-wetherbeei_contig9425.1.1 vs. uniprot
Match: A0A6S8BTP7_9STRA (Hypothetical protein (Fragment) n=1 Tax=Aureoumbra lagunensis TaxID=44058 RepID=A0A6S8BTP7_9STRA) HSP 1 Score: 69.7 bits (169), Expect = 4.530e-13 Identity = 35/35 (100.00%), Postives = 35/35 (100.00%), Query Frame = 0 Query: 1 MQIFVKTLTGKTITLDVEPSDTIDNVKQKIQDKEG 35 MQIFVKTLTGKTITLDVEPSDTIDNVKQKIQDKEG Sbjct: 17 MQIFVKTLTGKTITLDVEPSDTIDNVKQKIQDKEG 51
BLAST of mRNA_P-wetherbeei_contig9425.1.1 vs. uniprot
Match: A0A6C0LW77_9ZZZZ (Ubiquitin-like domain-containing protein n=4 Tax=viral metagenome TaxID=1070528 RepID=A0A6C0LW77_9ZZZZ) HSP 1 Score: 68.9 bits (167), Expect = 4.570e-13 Identity = 33/35 (94.29%), Postives = 35/35 (100.00%), Query Frame = 0 Query: 1 MQIFVKTLTGKTITLDVEPSDTIDNVKQKIQDKEG 35 MQIF+KTLTGKTITLDVEPSDTIDN+KQKIQDKEG Sbjct: 7 MQIFIKTLTGKTITLDVEPSDTIDNIKQKIQDKEG 41
BLAST of mRNA_P-wetherbeei_contig9425.1.1 vs. uniprot
Match: A0A7S1UFV6_9STRA (Hypothetical protein n=2 Tax=Ochrophyta TaxID=2696291 RepID=A0A7S1UFV6_9STRA) HSP 1 Score: 69.7 bits (169), Expect = 5.250e-13 Identity = 35/35 (100.00%), Postives = 35/35 (100.00%), Query Frame = 0 Query: 1 MQIFVKTLTGKTITLDVEPSDTIDNVKQKIQDKEG 35 MQIFVKTLTGKTITLDVEPSDTIDNVKQKIQDKEG Sbjct: 41 MQIFVKTLTGKTITLDVEPSDTIDNVKQKIQDKEG 75
BLAST of mRNA_P-wetherbeei_contig9425.1.1 vs. uniprot
Match: A0A6C0CQN9_9ZZZZ (Ubiquitin-like domain-containing protein n=5 Tax=root TaxID=1 RepID=A0A6C0CQN9_9ZZZZ) HSP 1 Score: 68.2 bits (165), Expect = 7.660e-13 Identity = 34/35 (97.14%), Postives = 35/35 (100.00%), Query Frame = 0 Query: 1 MQIFVKTLTGKTITLDVEPSDTIDNVKQKIQDKEG 35 MQIFVKTLTGKTITLDVEPSDTI+NVKQKIQDKEG Sbjct: 1 MQIFVKTLTGKTITLDVEPSDTIENVKQKIQDKEG 35
BLAST of mRNA_P-wetherbeei_contig9425.1.1 vs. uniprot
Match: W2H3L7_PHYPR (Polyubiquitin n=1 Tax=Phytophthora parasitica TaxID=4792 RepID=W2H3L7_PHYPR) HSP 1 Score: 68.2 bits (165), Expect = 7.660e-13 Identity = 34/35 (97.14%), Postives = 35/35 (100.00%), Query Frame = 0 Query: 1 MQIFVKTLTGKTITLDVEPSDTIDNVKQKIQDKEG 35 MQIFVKTLTGKTITLDVEPSD+IDNVKQKIQDKEG Sbjct: 1 MQIFVKTLTGKTITLDVEPSDSIDNVKQKIQDKEG 35
BLAST of mRNA_P-wetherbeei_contig9425.1.1 vs. uniprot
Match: A0A6C0AKM4_9ZZZZ (Ubiquitin-like domain-containing protein n=2 Tax=root TaxID=1 RepID=A0A6C0AKM4_9ZZZZ) HSP 1 Score: 68.2 bits (165), Expect = 8.270e-13 Identity = 34/35 (97.14%), Postives = 35/35 (100.00%), Query Frame = 0 Query: 1 MQIFVKTLTGKTITLDVEPSDTIDNVKQKIQDKEG 35 MQIFVKTLTGKTITLDVEPSDTI+NVKQKIQDKEG Sbjct: 1 MQIFVKTLTGKTITLDVEPSDTIENVKQKIQDKEG 35 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig9425.1.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topInterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_P-wetherbeei_contig9425.1.1 ID=prot_P-wetherbeei_contig9425.1.1|Name=mRNA_P-wetherbeei_contig9425.1.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=117bpback to top |