prot_P-wetherbeei_contig9392.2.1 (polypeptide) Phaeothamnion wetherbeei SAG_119_79
Overview
Homology
BLAST of mRNA_P-wetherbeei_contig9392.2.1 vs. uniprot
Match: A0A833QHP5_9POAL (Protein FAR1-RELATED SEQUENCE n=1 Tax=Carex littledalei TaxID=544730 RepID=A0A833QHP5_9POAL) HSP 1 Score: 53.1 bits (126), Expect = 3.670e-5 Identity = 34/127 (26.77%), Postives = 52/127 (40.94%), Query Frame = 0 Query: 5 AFTNHEDTAAFTWIFKHFKEACCPRDATGKPIEPVTIITDADPAAAAGVRAELPNSKHFLCSWHFMMNVNKHASEAWGGXXXXXSKKEGGDVTEESTDKMEFLRLFKKAMYST-SEAAFDGHWATLM 130 AF +E ++ W+F+ F E+ P ++ TD +PAAA + LP+++H LC WH + N+ H S F LF K M SE F+ WA ++ Sbjct: 339 AFLLNESVESYEWLFRSFVESMGGH-------APKSLFTDQNPAAAKAIENVLPDTRHCLCQWHVLKNMESHLGT--------------------SNMSRTFQTLFTKCMNGCESEMEFEETWARMV 438 The following BLAST results are available for this feature:
BLAST of mRNA_P-wetherbeei_contig9392.2.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_P-wetherbeei_contig9392.2.1 ID=prot_P-wetherbeei_contig9392.2.1|Name=mRNA_P-wetherbeei_contig9392.2.1|organism=Phaeothamnion wetherbeei SAG_119_79|type=polypeptide|length=159bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|